Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RASSLGEIDESSELRVLDIPGQDSETVFDIQNDRNSILPKSQSEYKPDTP QSGLEYSGIQELEDRRSQQRFQFNLQDFRCCAVLGRGHFGKVLLAEYKNT
    • Amino acids
      580 to 679
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159208 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cardiolipin activated protein kinase Pak2
    • MGC150606
    • MGC71074
    • PAK 2
    • PAK2
    • PKN gamma
    • PKN2
    • PKN2_HUMAN
    • PRK2
    • PRKCL2
    • PRO2042
    • Protein kinase C like 2
    • Protein kinase C related kinase 2
    • Protein kinase C-like 2
    • Protein kinase N2
    • Protein-kinase C-related kinase 2
    • Serine/threonine-protein kinase N2
    see all
  • Function
    Exhibits a preference for highly basic protein substrates.
  • Sequence similarities
    Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 1 C2 domain.
    Contains 1 protein kinase domain.
    Contains 3 REM (Hr1) repeats.
  • Domain
    The C1 domain does not bind the diacylglycerol (DAG).
  • Post-translational
    modifications
    Autophosphorylated.
    Activated by limited proteolysis with trypsin.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab159208 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159208 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159208.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up