Recombinant Human Placental alkaline phosphatase (PLAP) protein (ab114268)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP05187
    • SpeciesHuman
    • SequenceMLGPCMLLLLLLLGLRLQLSLGIIPVEEENPDFWNREAAEALGAAKKLQP AQTAAKNLIIFLGDGMGVSTVTAARILKGQKKDKLGPEIPLAMDRFPYVA LSKTYNVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNE VISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASA RQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRL DGKNLVQEWLAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEI HRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRAL TETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLA PGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLD EETHAGEDVAVFARGPQAHLVHGVQEQTFIAHVMAFAACLEPYTACDLAP PAGTTDAAHPGRSVVPALLPLLAGTLLLLETATAP
    • Molecular weight85 kDa including tags
    • Amino acids1 to 535

Specifications

Our Abpromise guarantee covers the use of ab114268 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Alkaline phosphatase
    • Alkaline phosphatase placental
    • Alkaline phosphatase placental type
    • Alkaline phosphatase Regan isozyme
    • ALP
    • Alp1
    • ALPP
    • FLJ61142
    • Germ-cell alkaline phosphatase
    • nagao isozyme
    • OTTHUMP00000164354
    • PALP
    • Placental alkaline phosphatase 1
    • placental heat-stable alkaline phosphatase
    • placental type
    • PLAP
    • PLAP-1
    • PLAP1
    • PPB1_HUMAN
    see all
  • Sequence similaritiesBelongs to the alkaline phosphatase family.
  • Cellular localizationCell membrane.
  • Information by UniProt

Recombinant Human Placental alkaline phosphatase (PLAP) protein images

  • 12.5% SDS-PAGE analysis of Human Placental alkaline phosphatase (PLAP) protein (ab114268). Stained with Coomassie Blue.

References for Recombinant Human Placental alkaline phosphatase (PLAP) protein (ab114268)

ab114268 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114268.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"