Recombinant Human Placental Protein 14 / Glycodelin A (ab114684)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP09466
    • SpeciesHuman
    • SequenceMLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSMAMATNNISLM ATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKF KINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEI MQGFIRAFRPLPRHLWYLLDLKQMEEPCRF
    • Molecular weight46 kDa including tags
    • Amino acids1 to 180

Specifications

Our Abpromise guarantee covers the use of ab114684 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Alpha uterine protein
    • gD
    • GdA
    • GdF
    • GdS
    • Glycodelin
    • Glycodelin A
    • Glycodelin F
    • Glycodelin S
    • MGC138509
    • MGC142288
    • PAEG
    • PAEP
    • PAEP_HUMAN
    • PEG
    • PEP
    • Placental protein 14
    • PP14
    • Pregnancy-associated endometrial alpha-2 globulin
    • Progestagen-associated endometrial protein
    • Progesterone-associated endometrial protein
    see all
  • FunctionThis protein is, quantitatively, the main protein synthesized and secreted in the endometrium from mid-luteal phase of the menstrual cycle and during the first semester of pregnancy.
  • Sequence similaritiesBelongs to the calycin superfamily. Lipocalin family.
  • Post-translational
    modifications
    At least two differentially glycosylated forms are found. Glycodelin-A (GdA) (amniotic fluid) with contraceptive and immunosuppressive activities and glycodelin-S (Gds) (seminal plasma) whose role is not yet known. The gender-specific glycosylation may serve to regulate key process involved in human reproduction.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human Placental Protein 14 / Glycodelin A images

  • ab114684 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Placental Protein 14 / Glycodelin A (ab114684)

ab114684 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114684.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"