Recombinant Human PLAGL1 / ZAC protein (ab116743)

Overview

  • Product nameRecombinant Human PLAGL1 / ZAC protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9UM63
    • SpeciesHuman
    • SequenceQPMQPLPESLASLHPSVSPGSPPPPLPNHKYNTTSTSYSPLASLPLKADT KGFCNISLFEDLPLQEPQSPQKLNPGFDLAKGNAGKVNLPKELPADAVNL
    • Molecular weight37 kDa including tags
    • Amino acids273 to 372

Specifications

Our Abpromise guarantee covers the use of ab116743 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • DKFZp781P1017
    • Lost on Transformation
    • Lost on transformation 1
    • LOT-1
    • LOT1
    • MGC126275
    • MGC126276
    • PLAG like 1
    • PLAGL1
    • PLAL1_HUMAN
    • Pleiomorphic adenoma gene like 1
    • Pleiomorphic adenoma gene like protein 1
    • Pleiomorphic adenoma-like protein 1
    • Tumor supressor ZAC
    • ZAC
    • ZAC tumor supressor
    • ZAC1
    • Zinc finger protein PLAGL1
    see all
  • FunctionShows weak transcriptional activatory activity. Transcriptional regulator of the type 1 receptor for pituitary adenylate cyclase-activating polypeptide.
  • Sequence similaritiesBelongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 7 C2H2-type zinc fingers.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human PLAGL1 / ZAC protein images

  • 12.5% SDS-PAGE of ab116743 at approximately 36.63kDa stained with Coomassie Blue.

References for Recombinant Human PLAGL1 / ZAC protein (ab116743)

ab116743 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116743.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"