Recombinant Human PLAGL1 / ZAC protein (ab116743)

Overview

  • Product name
    Recombinant Human PLAGL1 / ZAC protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QPMQPLPESLASLHPSVSPGSPPPPLPNHKYNTTSTSYSPLASLPLKADT KGFCNISLFEDLPLQEPQSPQKLNPGFDLAKGNAGKVNLPKELPADAVNL
    • Molecular weight
      37 kDa including tags
    • Amino acids
      273 to 372

Specifications

Our Abpromise guarantee covers the use of ab116743 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • DKFZp781P1017
    • Lost on Transformation
    • Lost on transformation 1
    • LOT-1
    • LOT1
    • MGC126275
    • MGC126276
    • PLAG like 1
    • PLAGL1
    • PLAL1_HUMAN
    • Pleiomorphic adenoma gene like 1
    • Pleiomorphic adenoma gene like protein 1
    • Pleiomorphic adenoma-like protein 1
    • Tumor supressor ZAC
    • ZAC
    • ZAC tumor supressor
    • ZAC1
    • Zinc finger protein PLAGL1
    see all
  • Function
    Shows weak transcriptional activatory activity. Transcriptional regulator of the type 1 receptor for pituitary adenylate cyclase-activating polypeptide.
  • Sequence similarities
    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 7 C2H2-type zinc fingers.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE of ab116743 at approximately 36.63kDa stained with Coomassie Blue.

References

ab116743 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116743.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up