Overview

  • Product nameRecombinant Human PLCL2 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMRIDSSNMNPQDFWKCGCQIVAMNFQTPGLMMDLNIGWFRQNGNCGYVLR PA IMREEVSFFSANTKDSVPGVSPQLLHIKIISGQNFPKPKGSGAKGD VVDPYV YVEIHGIPADCAEQRTKTVHQNGDAPIFDESFEFQINLPELA MVRFVVLDDD YIGDEFIGQYTIPFECLQTGYRHVPLQSLTGEVLAHAS LFVHVAITNRRGGG KPHKRGLSVRKGKKSREYASLRTLWIKTVDEVFK NAQPPIRDATDLRENMQN AVVSFKELCGLSSVANLMQCMLAVSPRFLG PDNTPLVVLNLSEQYPTMELQG IVPEVLKKIVTTYDMMIQSLKALIEN ADAVYEKIVHCQKAAMEFHEHLHSIG TKEGLKERKLQKAVESFTWNIT ILKGQADLLKYAKNETLENLKQIHFAAVSC GLNKPGTENADVQKPRRS LEVIPEKANDETGE
    • Amino acids554 to 1001

Specifications

Our Abpromise guarantee covers the use of ab91794 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • FormLyophilised
  • Additional notesProtein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch).
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5

  • ReconstitutionReconstitute with 106 µl aqua dest.

General Info

  • Alternative names
    • FLJ13484
    • Inactive phospholipase C like protein 2
    • Inactive phospholipase C-like protein 2
    • KIAA1092
    • Phospholipase C epsilon 2
    • Phospholipase C L2
    • Phospholipase C like 2
    • Phospholipase C-epsilon-2
    • Phospholipase C-L2
    • PLC epsilon 2
    • PLC L(2)
    • PLC L2
    • PLC-epsilon-2
    • PLC-L(2)
    • PLC-L2
    • PLCE 2
    • PLCE2
    • PLCL 2
    • PLCL2
    • PLCL2_HUMAN
    see all
  • FunctionMay play an role in the regulation of Ins(1,4,5)P3 around the endoplasmic reticulum.
  • Sequence similaritiesContains 1 C2 domain.
    Contains 1 PH domain.
    Contains 1 PI-PLC X-box domain.
    Contains 1 PI-PLC Y-box domain.
  • Cellular localizationCytoplasm. Predominantly localized to perinuclear areas in both myoblast and myotube C2C12 cells.
  • Information by UniProt

Recombinant Human PLCL2 protein images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References for Recombinant Human PLCL2 protein (ab91794)

ab91794 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab91794.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"