Overview

  • Product name
    Recombinant Human PLD6 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGRLSWQVAAAAAVGLALTLEALPWVLRWLRSRRRRPRREAPFFPSQVTC TEALLRAPGAELAELPEGCPCGLPHGESALSRLLRALLAARASLDLCLFA FSSPQLGHAVQLLHQRGVRVRVVTDCDYMALNGSQIGLLRKAGIQVRHDQ DPGYMHHKFAIVDKRVLITGSLNWTTQAIQNNRENVLITEDDEYVRLFLE EFERIWEQFNPTKYTFFPPKKSHGSCAPPVSRAGGRLLSWHRTCGTSSES QT
    • Amino acids
      1 to 252
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165881 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Choline phosphatase 6
    • Mitochondrial cardiolipin hydrolase
    • Mitochondrial phospholipase
    • MitoPLD
    • Phosphatidylcholine hydrolyzing phospholipase D6
    • Phosphatidylcholine-hydrolyzing phospholipase D6
    • Phospholipase D family member 6
    • Phospholipase D6
    • PLD 6
    • pld6
    • PLD6_HUMAN
    • Protein zucchini homolog
    • ZUC
    • Zucchini, Drosophila, homolog of
    see all
  • Function
    Cardiolipin hydrolase present at the mitochondrial outer membrane required both for mitochondrial fusion and piRNA metabolic process. Acts by catalyzing the hydrolysis of cardiolipin (diphosphatidylglycerol) to form phosphatidate (phosphatidic acid or PA) at the mitochondrial outer membrane surface, promoting mitochondrial fusion. The production of phosphatidate also regulates the piRNA metabolic process by promoting recruitment and/or activation of components of the meiotic nuage, also named P granule, a critical step for primary biogenesis of piRNAs. Required during spermatogenesis to repress transposable elements and prevent their mobilization via its role in the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and govern the methylation and subsequent repression of transposons.
  • Tissue specificity
    Widely expressed. Expression is not limites to testis and ovary.
  • Sequence similarities
    Belongs to the phospholipase D family. MitoPLD/Zucchini subfamily.
    Contains 1 PLD phosphodiesterase domain.
  • Domain
    In contrast to other members of the phospholipase D family, contains only one PLD phosphodiesterase domain, suggesting that it has a single half-catalytic and requires homodimerization to form a complete active site (PubMed:17028579).
  • Cellular localization
    Mitochondrion outer membrane.
  • Information by UniProt

Images

  • ab165881 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165881 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165881.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up