Recombinant Human Pleckstrin protein (ab116860)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP08567
    • SpeciesHuman
    • SequenceMEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPL KGSTLTSPCQDFGKRMFVFKITTTKQQDHFFQAAFLEERDAWVRDINKAI KCIEGGQKFARKSTRRSIRLPETIDLGALYLSMKDTEKGIKELNLEKDKK IFNHCFTGNCVIDWLVSNQSVRNRQEGLMIASSLLNEGYLQPAGDMSKSA VDGTAENPFLDNPDAFYYFPDSGFFCEENSSDDDVILKEEFRGVIIKQGC LLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSV ESNSNGRKSEEENLFEIITADEVHYFLQAATPKERTEWIKAIQMASRTGK
    • Molecular weight67 kDa including tags
    • Amino acids1 to 350

Specifications

Our Abpromise guarantee covers the use of ab116860 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ27168
    • OTTHUMP00000159962
    • p47
    • Platelet 47 kDa protein
    • Platelet and leukocyte C kinase substrate
    • Platelet P47
    • Platelet p47 protein
    • Pleckstrin
    • PLEK
    • PLEK_HUMAN
    see all
  • FunctionMajor protein kinase C substrate of platelets.
  • Sequence similaritiesContains 1 DEP domain.
    Contains 2 PH domains.
  • Information by UniProt

Recombinant Human Pleckstrin protein images

  • ab116860 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human Pleckstrin protein (ab116860)

ab116860 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116860.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"