Recombinant Human Pleckstrin protein (ab116861)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP08567
    • SpeciesHuman
    • SequencePETIDLGALYLSMKDTEKGIKELNLEKDKKIFNHCFTGNCVIDWLVSNQS VRNRQEGLMIASSLLNEGYLQPAGDMSKSAVDGTAENPFLDNPDAFYYFP DSGFFCEENS
    • Molecular weight38 kDa including tags
    • Amino acids121 to 230

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116861 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ27168
    • OTTHUMP00000159962
    • p47
    • Platelet 47 kDa protein
    • Platelet and leukocyte C kinase substrate
    • Platelet P47
    • Platelet p47 protein
    • Pleckstrin
    • PLEK
    • PLEK_HUMAN
    see all
  • FunctionMajor protein kinase C substrate of platelets.
  • Sequence similaritiesContains 1 DEP domain.
    Contains 2 PH domains.
  • Information by UniProt

Recombinant Human Pleckstrin protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116861 at approximately 37.73 kDa.

References for Recombinant Human Pleckstrin protein (ab116861)

ab116861 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116861.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"