Recombinant Human PLEKHM1 protein (ab160680)

Overview

  • Product name
    Recombinant Human PLEKHM1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PHRFSVADLQQIADGVYEGFLKALIEFASQHVYHCDLCTQRGFICQICQH HDIIFPFEFDTTVRCAECKTVFHQSCQAVVKKGCPRCARRRKYQEQNIFA
    • Amino acids
      957 to 1056
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160680 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 162 kDa adapter protein
    • AP162
    • PH domain-containing family M member 1
    • PKHM1_HUMAN
    • Pleckstrin homology domain-containing family M member 1
    • PLEKHM1
    see all
  • Function
    Involved in vesicular transport in the osteoclast (By similarity). May have a role in sialyl-lex-mediated transduction of apoptotic signals.
  • Tissue specificity
    Expressed in placenta, liver, prostate, thymus, spleen, ovary, colon, colon carcinoma and peripheral blood lymphocytes (PBL). Weakly expressed in brain, lung, kidney, and testis. No expression in heart, skeletal muscle, pancreas and small intestine. Predominantly expressed in the breast carcinoma cell line MCF-7.
  • Involvement in disease
    Defects in PLEKHM1 are the cause of osteopetrosis autosomal recessive type 6 (OPTB6) [MIM:611497]; also known as autosomal recessive osteopetrosis intermediate form. Osteopetrosis is a rare genetic disease characterized by abnormally dense bone, due to defective resorption of immature bone. The disorder occurs in two forms: a severe autosomal recessive form occurring in utero, infancy, or childhood, and a benign autosomal dominant form occurring in adolescence or adulthood. Autosomal recessive osteopetrosis is usually associated with normal or elevated amount of non-functional osteoclasts.
  • Sequence similarities
    Contains 2 PH domains.
    Contains 1 phorbol-ester/DAG-type zinc finger.
    Contains 1 RUN domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab160680 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160680 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160680.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up