Recombinant Human Plexin A2 protein (ab114912)

Overview

  • Product name
    Recombinant Human Plexin A2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MHSQVFSAFPYSLPLRFWVNVIKNPQFVFDIHKGSITDACLSVVAQTFMD SCSTSEHRLDKDSPSNKLLYAKDIPSYKSWVERYYADIAKLPAISDQDMN AYLAEQSRLHAVEFNMLSALNEIYSYVSKYSEELIGALEQDEQARRQRLA YKVEQLINAMSIES
    • Molecular weight
      44 kDa including tags
    • Amino acids
      1 to 165

Specifications

Our Abpromise guarantee covers the use of ab114912 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Plexin-A2
    • PlexinA2
    • PLXA2
    • PLXA2_HUMAN
    • PLXNA2
    • Semaphorin receptor OCT
    see all
  • Function
    Coreceptor for SEMA3A. Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance, invasive growth and cell migration. Class 3 semaphorins bind to a complex composed of a neuropilin and a plexin. The plexin modulates the affinity of the complex for specific semaphorins, and its cytoplasmic domain is required for the activation of down-stream signaling events in the cytoplasm.
  • Tissue specificity
    Detected in fetal brain.
  • Sequence similarities
    Belongs to the plexin family.
    Contains 4 IPT/TIG domains.
    Contains 1 Sema domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Recombinant Human Plexin A2 protein images

  • 12.5% SDS-PAGE showing ab114912 at approximately 44.15kDa.
    Stained with Coomassie Blue.

References for Recombinant Human Plexin A2 protein (ab114912)

ab114912 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114912.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up