Overview

  • Product nameRecombinant Human PLGLB2 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMEHKEVVLLLLLFLKSGQGEPLDDYVNTQGPSLFSVTKKQLGAGSREECA AKCEEDKEF TCRAFQYHSKEQQCVIMAENRKSSIIIRMRDAVLFEK

Associated products

Specifications

Our Abpromise guarantee covers the use of ab88023 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab88023 was purified using affinity chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • Plasminogen like B2
    • Plasminogen pseudogene 1
    • Plasminogen related protein B
    • PLGLB 2
    • PLGP 1
    • PLGP1
    • Type B plasminogen related
    see all
  • RelevancePlasminogen related protein B is encoded by the PLGLB1 and PLGLB2 genes. It may bind to lysine binding sites present in the kringle structures of plasminogen interfering with the binding of fibrin or alpha-2-antiplasmin to plasminogen.
  • Cellular localizationSecreted

References for Recombinant Human PLGLB2 protein (ab88023)

ab88023 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab88023.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"