Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MELLRTITYQPAASTKMCEQALGKGCGADSKKKRPPQPPEESQPPQSQAQ VPPAAPHHHHHHSHSGPEISRIIVDPTTGKRYCRGKVLGKGGFAKCYEMT DLTNNKVYAAKIIPHSRVAKPHQREKIDKEIELHRILHHKHVVQFYHYFE DKENIYILLEYCSRRSMAHILKARKVLTEPEVRYYLRQIVSGLKYLHEQE ILHRDLKLGNFFINEAMELKVGDFGLAARLEPLEHRRRTICGTPNYLSPE VLNKQGHGCESDIWALGCVMYTMLLGRPPFETTNLKETYRCIREARYTMP SSLLAPAKHLIASMLSKNPEDRPSLDDIIRHDFFLQGFTPDRLSSSCCHT VPDFHLSSPAKNFFKKAAAALFGGKKDKARYIDTHNRVSKEDEDIYKLRH DLKKTSITQQPSKHRTDEELQPPTTTVARSGTPAVENKQQIGDAIRMIVR GTLGSCSSSSECLEDSTMGSVADTVARVLRGCLENMPEADCIPKEQLSTS FQWVTKWVDYSNKYGFGYQLSDHTVGVLFNNGAHMSLLPDKKTVHYYAEL GQCSVFPATDAPEQFISQVTVLKYFSHYMEENLMDGGDLPSVTDIRRPRL YLLQWLKSDKALMMLFNDGTFQVNFYHDHTKIIICSQNEEYLLTYINEDR ISTTFRLTTLLMSGCSSELKNRMEYALNMLLQRCN
    • Amino acids
      1 to 685
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153125 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • hPlk2
    • hSNK
    • PLK-2
    • Plk2
    • PLK2_HUMAN
    • Polo like kinase 2
    • Polo-like kinase 2
    • Serine/threonine protein kinase PLK2
    • Serine/threonine protein kinase SNK
    • Serine/threonine-protein kinase PLK2
    • Serine/threonine-protein kinase SNK
    • Serum Induced Kinase
    • Serum-inducible kinase
    • SNK
    see all
  • Function
    May play a role in the division of at least some cell types, such as fibroblasts, and could function in embryogenesis, wound healing or neoplasia.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. CDC5/Polo subfamily.
    Contains 2 POLO box domains.
    Contains 1 protein kinase domain.
  • Information by UniProt

Images

  • ab153125 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153125 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153125.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up