Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEPAAGFLSPRPFQRAAAAPAPPAGPGPPPSALRGPELEMLAGLPTSDPG RLITDPRSGRTYLKGRLLGKGGFARCYEATDTETGSAYAVKVIPQSRVAK PHQREKILNEIELHRDLQHRHIVRFSHHFEDADNIYIFLELCSRKSLAHI WKARHTLLEPEVRYYLRQILSGLKYLHQRGILHRDLKLGNFFITENMELK VGDFGLAARLEPPEQRKKTICGTPNYVAPEVLLRQGHGPEADVWSLGCVM YTLLCGSPPFETADLKETYRCIKQVHYTLPASLSLPARQLLAAILRASPR DRPSIDQILRHDFFTKGYTPDRLPISSCVTVPDLTPPNPARSLFAKVTKS LFGRKKKSKNHAQERDEVSGLVSGLMRTSVGHQDARPEAPAASGPAPVSL VETAPEDSSPRGTLASSGDGFEEGLTVATVVESALCALRNCIAFMPPAEQ NPAPLAQPEPLVWVSKWVDYSNKFGFGYQLSSRRVAVLFNDGTHMALSAN RKTVHYNPTSTKHFSFSVGAVPRALQPQLGILRYFASYMEQHLMKGGDLP SVEEVEVPAPPLLLQWVKTDQALLMLFSDGTVQVNFYGDHTKLILSGWEP LLVTFVARNRSACTYLASHLRQLGCSPDLRQRLRYALRLLRDRSPA
    • Amino acids
      1 to 646
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158149 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CNK
    • Cytokine Inducible Kinase
    • Cytokine-inducible serine/threonine-protein kinase
    • FGF inducible kinase
    • FGF-inducible kinase
    • FNK
    • PLK-3
    • Plk3
    • PLK3_HUMAN
    • Polo Like Kinase 3
    • Polo-like kinase 3
    • PRK
    • Proliferation Related Kinase
    • Proliferation-related kinase
    • Serine/threonine-protein kinase PLK3
    see all
  • Function
    Serine/threonine protein kinase involved in regulating M phase functions during the cell cycle. May also be part of the signaling network controlling cellular adhesion. In vitro, is able to phosphorylate CDC25C and casein.
  • Tissue specificity
    Transcripts are highly detected in placenta, lung, followed by skeletal muscle, heart, pancreas, ovaries and kidney and weakly detected in liver and brain. May have a short half-live. In cells of hematopoietic origin, strongly and exclusively detected in terminally differentiated macrophages. Transcript expression appears to be down-regulated in primary lung tumor.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. CDC5/Polo subfamily.
    Contains 2 POLO box domains.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Phosphorylated as cells enter mitosis and dephosphorylated as cells exit mitosis.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab158149 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158149 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158149.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up