Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO00469
    • SpeciesHuman
    • SequenceDSEKPSSIPTDKLLVITVATKESDGFHRFMQSAKYFNYTVKVLGQGEEWR GGDGINSIGGGQKVRLMKEVMEHYADQDDLVVMFTECFDVIFAGGPEEVL KKFQKANHKVVFAADGILWPDKRLADKYPVVHIGKRYLNSGGFIGYAPYV NRIVQQWNLQDNDDDQLFYTKVYIDPLKREAINITLDHKCKIFQTLNGAV DEVVLKFENGKARAKNTFYETLPVAINGNGPTKILLNYFGNYVPNSWTQD NGCTLCEFDTVDLSAVDVHPNVSIGVFIEQPTPFLPRFLDILLTLDYPKE ALKLFIHNKEVYHEKDIKVFFDKAKHEIKTIKIVGPEENLSQAEARNMGM DFCRQDEKCDYYFSVDADVVLTNPRTLKILIEQNRKIIAPLVTRHGKLWS NFWGALSPDGYYARSEDYVDIVQGNRVGVWNVPYMANVYLIKGKTLRSEM NERNYFVRDKLDPDMALCRNAREMTLQREKDSPTPETFQMLSPPKGVFMY ISNRHEFGRLLSTANYNTSHYNNDLWQIFENPVDWKEKYINRDYSKIFTE NIVEQPCPDVFWFPIFSEKACDELVEEMEHYGKWSGGKHHDSRISGGYEN VPTDDIHMKQVDLENVWLHFIREFIAPVTLKVFAGYYTKGFALLNFVVKY SPERQRSLRPHHDASTFTINIALNNVGEDFQGGGCKFLRYNCSIESPRKG WSFMHPGRLTHLHEGLPVKNGTRYIAVSFIDP
    • Molecular weight107 kDa including tags
    • Amino acids27 to 758

Specifications

Our Abpromise guarantee covers the use of ab116924 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2-oxoglutarate 5-dioxygenase 2
    • LH2
    • Lysine hydroxylase 2
    • Lysyl hydroxylase 2
    • OTTHUMP00000215204
    • OTTHUMP00000215205
    • OTTHUMP00000215206
    • PLOD 2
    • Plod2
    • PLOD2_HUMAN
    • Procollagen lysine 2 oxoglutarate 5 dioxygenase 2
    • Procollagen lysine, 2 oxoglutarate 5 dioxygenase (lysine hydroxylase) 2
    • Procollagen-lysine
    • Telopeptide lysyl hydroxylase
    • TLH
    see all
  • FunctionForms hydroxylysine residues in -Xaa-Lys-Gly- sequences in collagens. These hydroxylysines serve as sites of attachment for carbohydrate units and are essential for the stability of the intermolecular collagen cross-links.
  • Tissue specificityHighly expressed in pancreas and muscle. Isoform 1 and isoform 2 are expressed in the majority of the examined cell types. Isoform 2 is specifically expressed in skin, lung, dura and aorta.
  • Involvement in diseaseDefects in PLOD2 are the cause of Bruck syndrome type 2 (BRKS2) [MIM:609220]. Bruck syndrome, also known as osteogenesis imperfecta with congenital joint contractures, is an autosomal recessive disease characterized by generalized osteopenia, joint contractures at birth, fragile bones and short stature. It can be distinguished from osteogenesis imperfecta by the absence of hearing loss and dentinogenesis imperfecta, and by the presence of clubfoot and congenital joint limitations. The molecular defect is an aberrant cross-linking of bone collagen, due to underhydroxylation of lysine residues within the telopeptides of type I collagen, whereas the lysine residues in the triple helix are normal.
  • Sequence similaritiesContains 1 Fe2OG dioxygenase domain.
  • Cellular localizationRough endoplasmic reticulum membrane.
  • Information by UniProt

Recombinant Human PLOD2 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116924 at approximately 106.63 kDa.

References for Recombinant Human PLOD2 protein (ab116924)

ab116924 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116924.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"