Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGGCTVRPQLLLLALVLHPWNPCLGADSEKPSSIPTDKLLVITVATKESD GFHRFMQSAKYFNYTVKVLGQGEEWRGGDGINSIGGGQKVRLMKEVMEHY ADQDDLVVMFTECFDVIFAGGPEEVLKKFQKANHKVVFAADGILWPDKRL ADKYPVVHIGKRYLNSGGFIGYAPYVNRIVQQWNLQDNDDDQLFYTKVYI DPLKREAINITLDHKCKIFQTLNGAVDEVVLKFENGKARAKNTFYETLPV AINGNGPTKILLNYFGNYVPNSWTQDNGCTLCEFDTVDLSAVDVHPNVSI GVFIEQPTPFLPRFLDILLTLDYPKEALKLFIHNKEVYHEKDIKVFFDKA KHEIKTIKIVGPEENLSQAEARNMGMDFCRQDEKCDYYFSVDADVVLTNP RTLKILIEQNRKIIAPLVTRHGKLWSNFWGALSPDGYYARSEDYVDIVQG NRVGVWNVPYMANVYLIKGKTLRSEMNERNYFVRDKLDPDMALCRNAREM TLQREKDSPTPETFQMLSPPKGVFMYISNRHEFGRLLSTANYNTSHYNND LWQIFENPVDWKEKYINRDYSKIFTENIVEQPCPDVFWFPIFSEKACDEL VEEMEHYGKWSGGKHHDSRISGGYENVPTDDIHMKQVDLENVWLHFIREF IAPVTLKVFAGYYTKGFALLNFVVKYSPERQRSLRPHHDASTFTINIALN NVGEDFQGGGCKFLRYNCSIESPRKGWSFMHPGRLTHLHEGLPVKNGTRY IAVSFIDP
    • Amino acids
      1 to 758
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159144 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2-oxoglutarate 5-dioxygenase 2
    • LH2
    • Lysine hydroxylase 2
    • Lysyl hydroxylase 2
    • OTTHUMP00000215204
    • OTTHUMP00000215205
    • OTTHUMP00000215206
    • PLOD 2
    • Plod2
    • PLOD2_HUMAN
    • Procollagen lysine 2 oxoglutarate 5 dioxygenase 2
    • Procollagen lysine, 2 oxoglutarate 5 dioxygenase (lysine hydroxylase) 2
    • Procollagen-lysine
    • Telopeptide lysyl hydroxylase
    • TLH
    see all
  • Function
    Forms hydroxylysine residues in -Xaa-Lys-Gly- sequences in collagens. These hydroxylysines serve as sites of attachment for carbohydrate units and are essential for the stability of the intermolecular collagen cross-links.
  • Tissue specificity
    Highly expressed in pancreas and muscle. Isoform 1 and isoform 2 are expressed in the majority of the examined cell types. Isoform 2 is specifically expressed in skin, lung, dura and aorta.
  • Involvement in disease
    Defects in PLOD2 are the cause of Bruck syndrome type 2 (BRKS2) [MIM:609220]. Bruck syndrome, also known as osteogenesis imperfecta with congenital joint contractures, is an autosomal recessive disease characterized by generalized osteopenia, joint contractures at birth, fragile bones and short stature. It can be distinguished from osteogenesis imperfecta by the absence of hearing loss and dentinogenesis imperfecta, and by the presence of clubfoot and congenital joint limitations. The molecular defect is an aberrant cross-linking of bone collagen, due to underhydroxylation of lysine residues within the telopeptides of type I collagen, whereas the lysine residues in the triple helix are normal.
  • Sequence similarities
    Contains 1 Fe2OG dioxygenase domain.
  • Cellular localization
    Rough endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab159144 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159144 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159144.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up