Overview

  • Product name
    Recombinant Human PLP2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MADSERLSAPGCWAACTNFSRTRKGILLFAEIILCLVILICFSASTPGYS SLSVIEMILAAIFFVVYMCDLHTKIPFINWPWSDFFRTLIAAILYLITSI VVLVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADG PV
    • Amino acids
      1 to 152
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159145 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A4
    • A4 differentiation dependent protein
    • A4-LSB
    • A4LSB
    • differentiation dependent protein A4
    • Differentiation-dependent protein A4
    • Intestinal membrane A4 protein
    • MGC126187
    • PLP2
    • PLP2_HUMAN
    • Proteolipid protein 2
    • proteolipid protein 2 (colonic epithelium enriched)
    see all
  • Function
    May play a role in cell differentiation in the intestinal epithelium.
  • Tissue specificity
    Enriched in colonic mucosa. The expression of A4 follows a gradient along the crypto-villus axis with the most abundant message occurring in the lower half of the crypt.
  • Sequence similarities
    Contains 1 MARVEL domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab159145 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159145 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159145.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up