Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      IINTLTVNSDGVLVSGADNGTMHLWDWRTGYNFQRVHAAVQPGSLDSESG IFACAFDQSESRLLTAEADKTIKVYREDDTATEETHPVSWKPEIIKRKRF
    • Molecular weight
      37 kDa including tags
    • Amino acids
      415 to 514

Specifications

Our Abpromise guarantee covers the use of ab116748 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Cwc1
    • MGC110980
    • Pleiotropic regulator 1
    • pleiotropic regulator 1 (PRL1 homolog, Arabidopsis)
    • PLRG 1
    • PLRG1
    • PLRG1_HUMAN
    • PRL 1
    • PRL1
    • PRL1, Arabidopsis, homolof of
    • PRP46
    • PRPF46
    • TANGO4
    • transport and golgi organization 4 homolog
    see all
  • Function
    Necessary for spliceosome assembly and for pre-mRNA splicing.
  • Sequence similarities
    Belongs to the WD repeat PRL1/PRL2 family.
    Contains 7 WD repeats.
  • Cellular localization
    Nucleus speckle.
  • Information by UniProt

Recombinant Human PLRG1 protein images

  • 12.5% SDS-PAGE analysis of ab116748 at approximately 36.63kDa, stained with Coomassie Blue.

References for Recombinant Human PLRG1 protein (ab116748)

ab116748 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116748.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up