Recombinant Human PLSCR3 protein (ab163466)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAGYLPPKGYAPSPPPPYPVTPGYPEPALHPGPGQAPVPAQVPAPAPGFA LFPSPGPVALGSAAPFLPLPGVPSGLEFLVQIDQILIHQKAERVETFLGW ETCNRYELRSGAGQPLGQAAEESNCCARLCCGARRPLRVRLADPGDRELL RLLRPLHCGCSCCPCGLQEMEVQAPPGTTIGHVLQTWHPFLPKFSIQDAD RQTVLRVVGPCWTCGCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTD ADDFGLQFPLDLDVRVKAVLLGATFLIDYMFFEKRGGAGPSAITS
    • Amino acids
      1 to 295
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163466 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Ca(2+)-dependent phospholipid scramblase 3
    • Phospholipid scramblase 3
    • PL scramblase 3
    • PLS3
    • PLS3_HUMAN
    • Plscr3
    see all
  • Function
    May mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. May play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system.
  • Tissue specificity
    Expressed in heart, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, uterus, small intestine and peripheral blood lymphocytes. Not detected in testis, brain and liver.
  • Sequence similarities
    Belongs to the phospholipid scramblase family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab163466 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163466 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163466.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up