Overview

  • Product name
    Recombinant Human PLTP protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      FPGCKIRVTSKALELVKQEGLRFLEQELETITIPDLRGKEGHFYYNISEV KVTELQLTSSELDFQPQQELMLQITNASLGLRFRRQLLYWFLKVYDFLST FITSGMRFLLNQQICPVLYHAGTVLLNSLLDTVPVRSSVDELVGIDYSLM KDPVASTSNLDMDFRGAFFPLTERNWSLPNRAVEPQLQEEERMVYVAFSE FFFDSAMESYFRAGALQLLLVGDKVPHDLDMLLRATYFGSIVLLSPAVID SPLKLELRVLAPPRCTIKPSGTTISVTASVTIALVPPDQPEVQLSSMTMD ARLSAKMALRGKALRTQLDLRRFRIYSNHSALESLALIPLQAPLKTMLQI GVMPMLNERTWRGVQIPLPEGINFVHEVVTNHAGFLTIGADLHFAKGLRE VIEKNRPADVRASTAPTPSTAAV
    • Molecular weight
      72 kDa including tags
    • Amino acids
      19 to 441

Specifications

Our Abpromise guarantee covers the use of ab114581 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/ul. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BPI fold containing family E
    • BPIFE
    • HDLCQ9
    • High density lipoprotein cholesterol level quantitative trait locus 9, included
    • Lipid transfer protein II
    • OD107
    • Phospholipid transfer protein
    • Plasma phospholipid transfer protein
    • Pltp
    • PLTP_HUMAN
    see all
  • Function
    Converts HDL into larger and smaller particles. May play a key role in extracellular phospholipid transport and modulation of hdl particles.
  • Tissue specificity
    Wide tissue distribution. Placenta > pancreas > lung > kidney > heart > liver > skeletal muscle > brain.
  • Sequence similarities
    Belongs to the BPI/LBP/Plunc superfamily. BPI/LBP family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Recombinant Human PLTP protein images

  • 12.5% SDS-PAGE showing ab114581 at approximately 72.05kDa stained with Coomassie Blue.

References for Recombinant Human PLTP protein (ab114581)

ab114581 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114581.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up