Overview

  • Product nameRecombinant Human PLTP protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP55058
    • SpeciesHuman
    • SequenceFPGCKIRVTSKALELVKQEGLRFLEQELETITIPDLRGKEGHFYYNISEV KVTELQLTSSELDFQPQQELMLQITNASLGLRFRRQLLYWFLKVYDFLST FITSGMRFLLNQQICPVLYHAGTVLLNSLLDTVPVRSSVDELVGIDYSLM KDPVASTSNLDMDFRGAFFPLTERNWSLPNRAVEPQLQEEERMVYVAFSE FFFDSAMESYFRAGALQLLLVGDKVPHDLDMLLRATYFGSIVLLSPAVID SPLKLELRVLAPPRCTIKPSGTTISVTASVTIALVPPDQPEVQLSSMTMD ARLSAKMALRGKALRTQLDLRRFRIYSNHSALESLALIPLQAPLKTMLQI GVMPMLNERTWRGVQIPLPEGINFVHEVVTNHAGFLTIGADLHFAKGLRE VIEKNRPADVRASTAPTPSTAAV
    • Molecular weight72 kDa including tags
    • Amino acids19 to 441

Specifications

Our Abpromise guarantee covers the use of ab114581 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/ul. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BPI fold containing family E
    • BPIFE
    • HDLCQ9
    • High density lipoprotein cholesterol level quantitative trait locus 9, included
    • Lipid transfer protein II
    • OD107
    • Phospholipid transfer protein
    • Plasma phospholipid transfer protein
    • Pltp
    • PLTP_HUMAN
    see all
  • FunctionConverts HDL into larger and smaller particles. May play a key role in extracellular phospholipid transport and modulation of hdl particles.
  • Tissue specificityWide tissue distribution. Placenta > pancreas > lung > kidney > heart > liver > skeletal muscle > brain.
  • Sequence similaritiesBelongs to the BPI/LBP/Plunc superfamily. BPI/LBP family.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human PLTP protein images

  • 12.5% SDS-PAGE showing ab114581 at approximately 72.05kDa stained with Coomassie Blue.

References for Recombinant Human PLTP protein (ab114581)

ab114581 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114581.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"