Recombinant Human Plzf protein (ab125992)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ05516
    • SpeciesHuman
    • SequenceGELAVGMKSESRTIGEQCSVCGVELPDNEAVEQHRKLHSGMKTYGCELCG KRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHRQTHTGTDM AVFCLLCGKRFQAQSALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLR SHTGDHPYECEFCGSCFRDESTLKSHKRIHTGEKPYECNGCGKKFSLKHQ LETHYRVHTGEKPFECKLCHQRSRDYSAMIKHLRTHNGASPYQCTICTEY CPSLSSMQKHMKGHKPEEIP
    • Amino acids389 to 658

Specifications

Our Abpromise guarantee covers the use of ab125992 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • FormLyophilised
  • Additional notesFor 50ug package, it is suggested to dissolve directly in 50ul DDW and the final concentration is 1.0ug/ul
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    Constituents: 0.32% Tris HCl, 0.58% Sodium chloride, 0.2% Guanidine HCl

  • ReconstitutionReconstitute with water to desired concentration.

General Info

  • Alternative names
    • AI467657
    • lu
    • PLZF
    • Promyelocytic leukemia zinc finger protein
    • ZBT16_HUMAN
    • ZBTB16
    • Zfp145
    • Zinc finger and BTB domain containing 16
    • zinc finger and BTB domain containing protein 16
    • Zinc finger and BTB domain-containing protein 16
    • Zinc finger protein 145
    • Zinc finger protein 145 (Kruppel like expressed in promyelocytic leukemia)
    • Zinc finger protein PLZF
    • Znf145
    see all
  • FunctionProbable transcription factor. May play a role in myeloid maturation and in the development and/or maintenance of other differentiated tissues. Probable substrate-recognition component of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
  • Tissue specificityWithin the hematopoietic system, PLZF is expressed in bone marrow, early myeloid cell lines and peripheral blood mononuclear cells. Also expressed in the ovary, and at lower levels, in the kidney and lung.
  • PathwayProtein modification; protein ubiquitination.
  • Involvement in diseaseSkeletal defects, genital hypoplasia, and mental retardation
    A chromosomal aberration involving ZBTB16 may be a cause of acute promyelocytic leukemia (APL). Translocation t(11;17)(q32;q21) with RARA.
  • Sequence similaritiesBelongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 1 BTB (POZ) domain.
    Contains 9 C2H2-type zinc fingers.
  • Cellular localizationNucleus.
  • Information by UniProt

References for Recombinant Human Plzf protein (ab125992)

ab125992 has not yet been referenced specifically in any publications.

Product Wall

Thank you for your reply.

I am sorry I am not an expert in this area, but have found some information that I hope would be useful to you.

The Antibody & Beyond websitesite provides a good list of markers for many cell types. I hav...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"