Overview

  • Product name
    Recombinant Human PMM1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAVTAQAARRKERVLCLFDVDGTLTPARQK IDPEVAAFLQKLRSRVQIGVVGGSDYCKIAEQLGDGDEVIEKFDYVFAEN GTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLRLPKKRGTFIE FRNGMLNISPIGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLR FSRGGMISFDVFPEGWDKRYCLDSLDQDSFDTIHFFGNETSPGGNDFEIF ADPRTVGHSVVSPQDTVQRCREIFFPETAHEA
    • Molecular weight
      32 kDa including tags
    • Amino acids
      1 to 262
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101111 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab101111 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, 0.1mM PMSF, pH 8.0

General Info

  • Alternative names
    • Brain glucose-1,6-bisphosphatase
    • Phosphomannomutase 1
    • PMM 1
    • pmm1
    • PMM1_HUMAN
    • PMMH 22
    • PMMH-22
    • PMMH22
    • Sec53
    see all
  • Function
    Involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions. In addition, may be responsible for the degradation of glucose-1,6-bisphosphate in ischemic brain.
  • Tissue specificity
    Strong expression in liver, heart, brain, and pancreas; lower expression in skeletal muscle.
  • Pathway
    Nucleotide-sugar biosynthesis; GDP-alpha-D-mannose biosynthesis; alpha-D-mannose 1-phosphate from D-fructose 6-phosphate: step 2/2.
  • Sequence similarities
    Belongs to the eukaryotic PMM family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab101111.

References

ab101111 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101111.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up