Overview

  • Product nameRecombinant Human PMM1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ92871
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAVTAQAARRKERVLCLFDVDGTLTPARQK IDPEVAAFLQKLRSRVQIGVVGGSDYCKIAEQLGDGDEVIEKFDYVFAEN GTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLRLPKKRGTFIE FRNGMLNISPIGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLR FSRGGMISFDVFPEGWDKRYCLDSLDQDSFDTIHFFGNETSPGGNDFEIF ADPRTVGHSVVSPQDTVQRCREIFFPETAHEA
    • Molecular weight32 kDa including tags
    • Amino acids1 to 262
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101111 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab101111 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, 0.1mM PMSF, pH 8.0

General Info

  • Alternative names
    • Brain glucose-1,6-bisphosphatase
    • Phosphomannomutase 1
    • PMM 1
    • pmm1
    • PMM1_HUMAN
    • PMMH 22
    • PMMH-22
    • PMMH22
    • Sec53
    see all
  • FunctionInvolved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions. In addition, may be responsible for the degradation of glucose-1,6-bisphosphate in ischemic brain.
  • Tissue specificityStrong expression in liver, heart, brain, and pancreas; lower expression in skeletal muscle.
  • PathwayNucleotide-sugar biosynthesis; GDP-alpha-D-mannose biosynthesis; alpha-D-mannose 1-phosphate from D-fructose 6-phosphate: step 2/2.
  • Sequence similaritiesBelongs to the eukaryotic PMM family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human PMM1 protein images

  • 15% SDS-PAGE analysis of 3µg ab101111.

References for Recombinant Human PMM1 protein (ab101111)

ab101111 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101111.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"