Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP02689
    • SpeciesHuman
    • SequenceMKHHHHHHASNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVI ISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSL NQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV
    • Molecular weight16 kDa
    • Amino acids2 to 132
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab115501 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Endotoxin level< 1.000 Eu/µg
  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.50
    Constituents: 0.24% Tris, 0.29% Sodium chloride

  • ReconstitutionAdd deionized water to prepare a working stock solution of 0.5 mg/mL and let the lyophilized pellet dissolve completely. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term storage. Reconstituted protein can be stored at 4°C for a week.

General Info

  • Alternative names
    • FABP8
    • M FABP
    • MP2
    • Myelin FABP
    • Myelin P2 protein
    • MYP2_HUMAN
    • P2
    • Peripheral myelin protein 2
    • PMP2
    see all
  • FunctionMay play a role in lipid transport protein in Schwann cells. May bind cholesterol.
  • Sequence similaritiesBelongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
  • DomainForms a beta-barrel structure that accommodates hydrophobic ligands in its interior.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human PMP2 protein images

  • 14% SDS-PAGE showing ab115501
    Lane 1: M.W. marker – 14, 21, 31, 45, 66, 97 kDa
    Lane 2: reduced and boiled sample, 5µg/lane.
    Lane 3: non-reduced and non-boiled sample, 5µg/lane.

References for Recombinant Human PMP2 protein (ab115501)

ab115501 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab115501.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"