Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP28288
    • SpeciesHuman
    • SequenceSELLEDYYQSGRMLLRMSQALGRIVLAGREMTRLAGFTARITELMQVLKD LNHGKYERTMVSQQEKGIEGVQVIPLIPGAGEIIIADNIIKFDHVPLAT
    • Molecular weight37 kDa including tags
    • Amino acids351 to 449

Specifications

Our Abpromise guarantee covers the use of ab114321 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 70 kDa peroxisomal membrane protein
    • ABC 43
    • ABC D3
    • ABC43
    • ABCD 3
    • Abcd3
    • ABCD3 protein
    • ABCD3_HUMAN
    • ATP binding cassette sub family D (ALD) member 3
    • ATP binding cassette sub family D member 3
    • ATP-binding cassette sub-family D member 3
    • Peroxisomal membrane protein 1
    • PMP 70
    • PMP70
    • PXMP 1
    • PXMP1
    • ZWS2
    see all
  • FunctionProbable transporter. The nucleotide-binding fold acts as an ATP-binding subunit with ATPase activity.
  • Sequence similaritiesBelongs to the ABC transporter superfamily. ABCD family. Peroxisomal fatty acyl CoA transporter (TC 3.A.1.203) subfamily.
    Contains 1 ABC transmembrane type-1 domain.
    Contains 1 ABC transporter domain.
  • Cellular localizationPeroxisome membrane.
  • Information by UniProt

Recombinant Human PMP70 protein images

  • SDS-PAGE analysis of ab114321 on a 12.5% gel stained with Coomassie Blue.

References for Recombinant Human PMP70 protein (ab114321)

ab114321 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114321.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"