Overview

  • Product name
    Recombinant Human PMVK protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAPLGGAPRLVLLFSGKRKSGKDFVTEALQ SRLGADVCAVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIRWG EEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQTVR VVALEQSRQQRGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQ LENLIEFIRSRL
    • Molecular weight
      24 kDa including tags
    • Amino acids
      1 to 192
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101170 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab101170 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • hPMK
    • HUMPMKI
    • OTTHUMP00000035546
    • Phosphomevalonate kinase
    • PMK
    • PMK PEN
    • PMKA
    • PMKase
    • PMKI
    • PMKPEN
    • PMVK
    • PMVK_HUMAN
    see all
  • Tissue specificity
    Heart, liver, skeletal muscle, kidney, and pancreas. Lower level in brain, placenta and lung.
  • Pathway
    Isoprenoid biosynthesis; isopentenyl diphosphate biosynthesis via mevalonate pathway; isopentenyl diphosphate from (R)-mevalonate: step 2/3.
  • Cellular localization
    Peroxisome.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab101170 at approximately 24.1kDa (3µg).

References

ab101170 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101170.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up