Overview

  • Product nameRecombinant Human PMVK protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ15126
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAPLGGAPRLVLLFSGKRKSGKDFVTEALQ SRLGADVCAVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIRWG EEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQTVR VVALEQSRQQRGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQ LENLIEFIRSRL
    • Molecular weight24 kDa including tags
    • Amino acids1 to 192
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101170 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab101170 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • hPMK
    • HUMPMKI
    • OTTHUMP00000035546
    • Phosphomevalonate kinase
    • PMK
    • PMK PEN
    • PMKA
    • PMKase
    • PMKI
    • PMKPEN
    • PMVK
    • PMVK_HUMAN
    see all
  • Tissue specificityHeart, liver, skeletal muscle, kidney, and pancreas. Lower level in brain, placenta and lung.
  • PathwayIsoprenoid biosynthesis; isopentenyl diphosphate biosynthesis via mevalonate pathway; isopentenyl diphosphate from (R)-mevalonate: step 2/3.
  • Cellular localizationPeroxisome.
  • Information by UniProt

Recombinant Human PMVK protein images

  • 15% SDS-PAGE showing ab101170 at approximately 24.1kDa (3µg).

References for Recombinant Human PMVK protein (ab101170)

ab101170 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101170.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"