Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLLLKKHTEDISSVYEIRERLGSGPSPLHSLSLLPLLSSHFLPTSHRPVC GRGAFSEVVLAQERGSAHLVALKCIPKKALRGKEALVENEIAVLRRISHP NIVALEDVHESPSHLYLAMEL
    • Amino acids
      1 to 121
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165441 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Calcium/calmodulin dependent protein kinase type 1B
    • Calcium/calmodulin-dependent protein kinase type 1B
    • CaM KI beta
    • CaM kinase I beta
    • CaM kinase IB
    • CaM-KI beta
    • CaMK1b
    • CaMKI beta
    • CaMKI-beta
    • EC 2.7.11.17
    • KCC1B_HUMAN
    • MGC45419
    • PNCK
    • Pregnancy up regulated non ubiquitously expressed CaM kinase
    • Pregnancy up-regulated non-ubiquitously-expressed CaM kinase
    see all
  • Function
    Calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade. In vitro phosphorylates CREB1 and SYN1/synapsin I. Phosphorylates and activates CAMK1.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. CaMK subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Phosphorylated by CAMKK1.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab165441 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165441 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165441.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up