Overview

  • Product name
    Recombinant Human PNO1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MESEMETQSARAEEGFTQVTRKGGRRAKKRQAEQLSAAGEGGDAGRMDTE EARPAKRPVFPPLCGDGLLSGKEETRKIPVPANRYTPLKENWMKIFTPIV EHLGLQIRFNLKSRNVEIRTCKETKDVSALTKAADFVKAFILGFQVEDAL ALIRLDDLFLESFEITDVKPLKGDHLSRAIGRIAGKGGKTKFTIENVTRT RIVLADVKVHILGSFQNIKMARTAICNLILGNPPSKVYGNIRAVASRSAD RF
    • Amino acids
      1 to 252
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163419 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KH type RNA binding protein 1
    • KHRBP 1
    • KHRBP1
    • Partner of NOB1
    • Partner of NOB1 homolog
    • Partner of NOB1 homolog (S. cerevisiae)
    • PNO 1
    • PNO1
    • PNO1_HUMAN
    • RNA binding protein
    • RNA binding protein PNO1
    • RNA-binding protein pno1
    see all
  • Tissue specificity
    Expressed in liver, lung, spleen and kidney. Weakly expressed in thymus, testis and ovary. Weakly or not expressed in heart, brain, skeletal muscle, placenta, pancreas, prostate, small intestine, colon and peripheral blood leukocytes.
  • Sequence similarities
    Belongs to the PNO1 family.
    Contains 1 KH domain.
  • Cellular localization
    Nucleus > nucleolus.
  • Information by UniProt

Images

  • ab163419 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163419 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163419.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up