Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9NVS9
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMDPVKQFAAWFEEAVQCPDIGEANAMCLAT CTRDGKPSARMLLLKGFGKDGFRFFTNFESRKGKELDSNPFASLVFYWEP LNRQVRVEGPVKKLPEEEAECYFHSRPKSSQIGAVVSHQSSVIPDREYLR KKNEELEQLYQDQEVPKPKSWGGYVLYPQVMEFWQGQTNRLHDRIVFRRG LPTGDSPLGPMTHRGEEDWLYERLAP
    • Molecular weight26 kDa including tags
    • Amino acids57 to 261
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101213 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab101213 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 0.1mM PMSF, pH 8.0

General Info

  • Alternative names
    • EC 1.4.3.5
    • FLJ10535
    • PDXPO
    • PNPO
    • PNPO_HUMAN
    • Pyridoxal 5' phosphate synthase
    • pyridoxamine 5' phosphate oxidase
    • Pyridoxamine phosphate oxidase
    • Pyridoxamine-phosphate oxidase
    • pyridoxine 5' phosphate oxidase
    • Pyridoxine-5'-phosphate oxidase
    see all
  • FunctionCatalyzes the oxidation of either pyridoxine 5'-phosphate (PNP) or pyridoxamine 5'-phosphate (PMP) into pyridoxal 5'-phosphate (PLP).
  • PathwayCofactor biosynthesis; B6 vitamer interconversion; pyridoxal 5'-phosphate from pyridoxamine 5'-phosphate: step 1/1.
    Cofactor biosynthesis; B6 vitamer interconversion; pyridoxal 5'-phosphate from pyridoxine 5'-phosphate: step 1/1.
  • Involvement in diseaseDefects in PNPO are the cause of pyridoxine-5'-phosphate oxidase deficiency (PNPO deficiency) [MIM:610090]; also known as PNPO-related neonatal epileptic encephalopathy. The main feature of neonatal epileptic encephalopathy is the onset within hours of birth of a severe seizure disorder that does not respond to anticonvulsant drugs and can be fatal. Seizures can cease with the administration of PLP, being resistant to treatment with pyridoxine.
  • Sequence similaritiesBelongs to the pyridoxamine 5'-phosphate oxidase family.
  • Information by UniProt

Recombinant Human PNPO protein images

  • 15% SDS-PAGE analysis of 3µg ab101213.

References for Recombinant Human PNPO protein (ab101213)

ab101213 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101213.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"