Overview

  • Product name
    Recombinant Human POLA2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSASAQQLAEELQIFGLDCEEALIEKLVELCVQYGQNEEGMVGELIAFCT STHKVGLTSEILNSFEHEFLSKRLSKARHSTCKDSGHAGARDIVSIQELI EVEEEEEILLNSYTTPSKGSQKRAISTPETPLTKRSVSTRSPHQLLSPSS FSPSATPSQKYNSRSNRGEVVTSFGLAQGVSWSGRGGAGNISLKVLGCPE ALTGSYKSMFQKLPDIREVLTCKIEELGSELKEHYKIEAFTPLLAPAQEP VTLLGQIGCDSNGKLNNKSVILEGDREHSSGAQIPVDLSELKEYSLFPGQ VVIMEGINTTGRKLVATKLYEGVPLPFYQPTEEDADFEQSMVLVACGPYT TSDSITYDPLLDLIAVINHDRPDVCILFGPFLDAKHEQVENCLLTSPFED IFKQCLRTIIEGTRSSGSHLVFVPSLRDVHHEPVYPQPPFSYSDLSREDK KQVQFVSEPCSLSINGVIFGLTSTDLLFHLGAEEISSSSGTSDRFSRILK HILTQRSYYPLYPPQEDMAIDYESFYVYAQLPVTPDVLIIPSELRYFVKD VLGCVCVNPGRLTKGQVGGTFARLYLRRPAADGAERQSPCIAVQVVRI
    • Amino acids
      1 to 598
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153243 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AI573378
    • DNA directed DNA polymerase alpha 2
    • DNA polymerase alpha 70 kDa subunit
    • DNA polymerase alpha subunit B
    • DNA polymerase alpha subunit II
    • DNA polymerase subunit alpha B
    • DNA polymerase subunit II
    • DPOA2_HUMAN
    • FLJ21662
    • FLJ37250
    • polA2
    • Polymerase (DNA directed) alpha 2 (70kD subunit)
    • Polymerase (DNA directed), alpha (70kD)
    • Polymerase (DNA directed), alpha 2 accessory subunit
    see all
  • Function
    May play an essential role at the early stage of chromosomal DNA replication by coupling the polymerase alpha/primase complex to the cellular replication machinery.
  • Sequence similarities
    Belongs to the DNA polymerase alpha subunit B family.
  • Domain
    The N-terminal 240 amino acids are sufficient to mediate complex formation.
  • Post-translational
    modifications
    Phosphorylated in a cell cycle-dependent manner, in G2/M phase.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab153243 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153243 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153243.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up