Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGRKRLITDSYPVVKRREGPAGHSKGELAPELGL
    • Amino acids
      1 to 34
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163656 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DNA polymerase delta smallest subunit p12
    • DNA polymerase subunit delta 4
    • DNA polymerase subunit delta p12
    • p12
    • POLD 4
    • POLDS
    • Polymerase (DNA directed) delta 4
    see all
  • Relevance
    POLD4 (Polymerase (DNA-directed), delta 4) is a subunit of the DNA polymerase delta complex, which is involved in DNA replication and repair. The function of subunit 4 is has not yet been determined.
  • Cellular localization
    Nuclear

Images

  • ab163656 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163656 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163656.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up