Recombinant Human POLDIP2 protein (ab153264)

Overview

  • Product name
    Recombinant Human POLDIP2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAACTARRALAVGSRWWSRSLTGARWPRPLCAAAGAGAFSPASTTTTRRH LSSRNRPEGKVLETVGVFEVPKQNGKYETGQLFLHSIFGYRGVVLFPWQA RLYDRDVASAAPEKAENPAGHGSKEVKGKTHTYYQVLIDARDCPHISQRS QTEAVTFLANHDDSRALYAIPGLDYVSHEDILPYTSTDQVPIQHELFERF LLYDQTKAPPFVARETLRAWQEKNHPWLELSDVHRETTENIRVTVIPFYM GMREAQNSHVYWWRYCIRLENLDSDVVQLRERHWRIFSLSGTLETVRGRG VVGREPVLSKEQPAFQYSSHVSLQASSGHMWGTFRFERPDGSHFDVRIPP FSLESNKDEKTPPSGLHW
    • Amino acids
      1 to 368
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153264 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 38 kDa DNA polymerase delta interaction protein
    • delta interacting protein 2
    • DNA polymerase delta interaction protein p38
    • p38
    • PDIP 2
    • PDIP 38
    • PDIP2
    • PDIP2_HUMAN
    • PDIP38
    • POLD 4
    • POLD4
    • Poldip2
    • Polymerase (DNA directed) delta interacting protein 2
    • Polymerase delta interacting protein 38
    • Polymerase delta-interacting protein 2
    see all
  • Sequence similarities
    Contains 1 apaG domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab153264 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153264 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153264.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up