Overview

  • Product name
    Recombinant Human POLE protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDPSNYGGIKGKVSSRIHCGLQDSQKAGGAEDEQENEDDEEERDGEEEEE AEESNVEDLLENNWNILQFLPQAASCQNYFLMIVSAYIVAVYHCMKDGLR RSAPGSTPVRRRGASQLSQEAEGAVGALPGMITFSQDYVANELTQSFFTI TQKIQKKVTGSRNSTELSEMFPVLPGSHLLLNNPALEFIKYVCKVLSLDT NITNQVNKLNRDLLRLVDVGEFSEEAQFRDPCRSYVLPEVICRSCNFCRD LDLCKDSSFSEDGAVLPQWLCSNCQAPYDSSAIEMTLVEVLQKKLVAFTL QDLVCLKCRGVKETSMPVYCSCAGDFALTIHTQVFMEQIGIFRNIAQHYG MSYLLETLEWLLQKNPQLGH
    • Amino acids
      1 to 370
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159152 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CRCS12
    • DKFZp434F222
    • DNA polymerase epsilon catalytic subunit
    • DNA polymerase epsilon catalytic subunit A
    • DNA polymerase II subunit A
    • DPOE1_HUMAN
    • EC 2.7.7.7
    • FILS
    • FLJ21434
    • POLE
    • POLE1
    • Polymerase (DNA directed) epsilon
    • polymerase (DNA directed), epsilon, catalytic subunit
    see all
  • Function
    Participates in DNA repair and in chromosomal DNA replication.
  • Sequence similarities
    Belongs to the DNA polymerase type-B family.
  • Domain
    The DNA polymerase activity domain resides in the N-terminal half of the protein, while the C-terminus is necessary for complexing subunits B and C. The C-terminus may also regulate the catalytic activities of the enzyme.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab159152 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159152 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159152.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up