Overview

  • Product name
    Recombinant Human POLG2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRSRVAVRACHKVCRCLLSGFGGRVGAGQPELLTERSSPKGGHVKSHAEL EGNGEHPEAPGSGEGSEALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFG PLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRLVSA ETLREILQDKELSKEQLVAFLENVLKTSGKLRENLLHGALEHYVNCLDLV NKRLPYGLAQIGVCFHPVFDTKQIRNGVKSIGEKTEASLVWFTPPRTSNQ WLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELI ETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYL YDSFQLTENSFTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQ GLFNELLENGISVWPAYLETMQSSLEQLYSKYDEMSILFTVLVTETTLEN GLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV
    • Amino acids
      1 to 485
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161363 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DNA directed DNA polymerase gamma 2
    • DNA polymerase gamma accessory 55 kDa subunit
    • DNA polymerase subunit gamma 2, mitochondrial
    • DNA polymerase subunit gamma-2
    • DPOG2_HUMAN
    • HP55
    • mitochondrial
    • Mitochondrial DNA polymerase accessory subunit
    • Mitochondrial DNA polymerase subunit gamma 2
    • Mitochondrial polymerase gamma 2
    • MtPolB
    • OTTMUSP00000003758
    • p55
    • PEOA4
    • POLB
    • PolG beta
    • PolG-beta
    • POLG2
    • POLGB
    • Polymerase (DNA directed), gamma 2, accessory subunit
    • Polymerase, gamma 2
    • RP23-247J12.3
    see all
  • Function
    Mitochondrial polymerase processivity subunit. Stimulates the polymerase and exonuclease activities, and increases the processivity of the enzyme. Binds to ss-DNA.
  • Involvement in disease
    Defects in POLG2 are the cause of progressive external ophthalmoplegia with mitochondrial DNA deletions autosomal dominant type 4 (PEOA4) [MIM:610131]. Progressive external ophthalmoplegia is characterized by progressive weakness of ocular muscles and levator muscle of the upper eyelid. In a minority of cases, it is associated with skeletal myopathy, which predominantly involves axial or proximal muscles and which causes abnormal fatigability and even permanent muscle weakness. Ragged-red fibers and atrophy are found on muscle biopsy. A large proportion of chronic ophthalmoplegias are associated with other symptoms, leading to a multisystemic pattern of this disease. Additional symptoms are variable, and may include cataracts, hearing loss, sensory axonal neuropathy, ataxia, depression, hypogonadism, and parkinsonism.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • ab161363 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161363 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161363.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up