Recombinant Human POLR1B protein (ab164514)

Overview

  • Product name
    Recombinant Human POLR1B protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GEMLKAAGYNFYGTERLYSGISGLELEADIFIGVVYYQRLRHMVSDKFQV RTTGARDRVTNQPIGGRNVQGGIRFGEMERDALLAHGTSFLLHDRLFNCS DRSVAHVCVK
    • Amino acids
      963 to 1072
    • Tags
      proprietary tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab164514 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A127
    • DNA directed RNA polymerase I
    • DNA directed RNA polymerase I 135kDa polypeptide
    • DNA directed RNA polymerase I subunit RPA2
    • DNA-directed RNA polymerase I 135 kDa polypeptide
    • DNA-directed RNA polymerase I subunit rpa2
    • FLJ10816
    • FLJ21921
    • MGC131780
    • OTTHUMP00000161989
    • OTTHUMP00000203643
    • OTTHUMP00000203645
    • POLR 1B
    • polr1b
    • Polymerase (RNA) I polypeptide B
    • Polymerase (RNA) I polypeptide B 128kDa
    • RNA polymerase I polypeptide B
    • RNA polymerase I subunit 2
    • RPA 135
    • RPA116
    • RPA135
    • RPA2
    • RPA2_HUMAN
    • Rpo1 2
    see all
  • Function
    DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Second largest core component of RNA polymerase I which synthesizes ribosomal RNA precursors. Proposed to contribute to the polymerase catalytic activity and forms the polymerase active center together with the largest subunit. Pol I is composed of mobile elements and RPA2 is part of the core element with the central large cleft and probably a clamp element that moves to open and close the cleft.
  • Sequence similarities
    Belongs to the RNA polymerase beta chain family.
  • Cellular localization
    Nucleus, nucleolus.
  • Information by UniProt

Images

  • ab164514 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164514 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164514.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up