Recombinant Human POLR1D protein (ab162407)

Overview

  • Product name
    Recombinant Human POLR1D protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEEDQELERKISGLKTSMAEGERKTALEMVQAAGTDRHCVTFVLHEEDHT LGNSLRYMIMKNPEVEFCGYTTTHPSESKINLRIQTRGTLPAVEPFQRGL NELMNVCQHVLDKFEASIKDYKDQKASRNESTF
    • Amino acids
      1 to 133
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162407 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AC19
    • DNA directed RNA polymerase I 16 kDa polypeptide
    • DNA directed RNA polymerase I subunit D
    • DNA directed RNA polymerases I and III subunit RPAC2
    • DNA-directed RNA polymerase I subunit D
    • DNA-directed RNA polymerases I and III subunit RPAC2
    • FLJ20616
    • hRPA19
    • MGC9850
    • POLR1C
    • POLR1D
    • Polymerase (RNA) I polypeptide D
    • Polymerase (RNA) I polypeptide D, 16kDa
    • RNA polymerase I 16 kDa subunit
    • RNA polymerases I and III subunit AC2
    • RPA16
    • RPA9
    • RPAC2
    • RPAC2_HUMAN
    • RPC16
    • RPO1 3
    see all
  • Function
    DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common core component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively.
  • Involvement in disease
    Treacher Collins syndrome 2
  • Sequence similarities
    Belongs to the archaeal RpoL/eukaryotic RPB11/RPC19 RNA polymerase subunit family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab162407 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162407 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162407.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up