Recombinant Human POLR3D protein (ab114942)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP05423
    • SpeciesHuman
    • SequenceGQVVLIKQEKDREAKLAENACTLADLTEGQVGKLLIRKSGRVQLLLGKVT LDVTMGTACSFLQELVSVGLGDSRTGEMTVLGHVKHKLVCSPDFESLLDH
    • Molecular weight37 kDa including tags
    • Amino acids296 to 395

Specifications

Our Abpromise guarantee covers the use of ab114942 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AI326118
    • AW489084
    • BN51
    • BN51 (BHK21) temperature sensitivity complementing
    • BN51T
    • DNA directed RNA polymerase III 47 kDa polypeptide
    • DNA directed RNA polymerase III subunit D
    • POLR3D
    • Polymerase (RNA) III (DNA directed) polypeptide D
    • Polymerase (RNA) III (DNA directed) polypeptide D, 44kDa
    • Protein BN51
    • RNA polymerase III subunit C4
    • RPC4
    • RPC53
    • Temperature sensitive complementation cell cycle specific tsBN51
    • TSBN51
    see all
  • RelevancePOLR3D is a DNA dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. It plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses and acts as nuclear and cytosolic DNA sensor involved in innate immune response.
  • Cellular localizationNuclear

Recombinant Human POLR3D protein images

  • ab114942 analyzed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human POLR3D protein (ab114942)

ab114942 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114942.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"