Recombinant Human POLR3E protein (ab163189)

Overview

  • Product name
    Recombinant Human POLR3E protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MANEEDDPVVQEIDVYLAKSLAEKLYLFQYPVRPASMTYDDIPHLSAKIK PKQQKVELEMAIDTLNPNYCRSKGEQIALNVDGACADETSTYSSKLMDKQ TFCSSQTTSNTSRYAAALYRQGELHLTPLHGILQLRPSFSYLDKADAKHR EREAANEAGDSSQDEAEDDVKQITVRFSRPESEQARQRRVQSYEFLQKKH AEEPWVHLHYYGLRDSRSEHERQYLLCPGSSGVENTELVKSPSEYLMMLM PPSQEEEKDKPVAPSNVLSMAQLRTLPLADQIKILMKNVKVMPFANLMSL LGPSIDSVAVLRGIQKVAMLVQGNWVVKSDILYPKDSSSPHSGVPAEVLC RGRDFVMWKFTQSRWVVRKEVATVTKLCAEDVMDFLEHMAVVRINKGWEF ILPYDGEFIKKHPDVVQRQHMLWTGIQAKLEKVYNLVKETMPKKPDAQSG PAGLVCGDQRIQVAKTKAQQNHALLERELQRRKEQLRVPAVPPGVRIKEE PVSEEGEEDEEQEAEEEPMDTSPSGLHSKLANGLPLGRAAGTDSFNGHPP QGCASTPVARELKAFVEATFQRQFVLTLSELKRLFNLHLASLPPGHTLFS GISDRMLQDTVLAAGCKQILVPFPPQTAASPDEQKVFALWESGDMSDQDC CVSYGGMWYLKGTVQS
    • Amino acids
      1 to 666
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163189 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DNA directed RNA polymerase III 80 kDa polypeptide
    • DNA-directed RNA polymerase III subunit RPC5
    • FLJ10509
    • KIAA1452
    • Polymerase (RNA) III (DNA directed) polypeptide E
    • polymerase (RNA) III (DNA directed) polypeptide E (80kD)
    • RNA polymerase III 80 kDa subunit RPC5
    • RNA polymerase III subunit C5
    • RPC5
    • SIN
    see all
  • Relevance
    DNA dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Essential for efficient transcription from both the type 2 VAI and type 3 U6 RNA polymerase III promoters. There are three isoforms.
  • Cellular localization
    Nuclear

Images

  • ab163189 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163189 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163189.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up