Recombinant Human POLR3G protein (ab161076)

Overview

  • Product name
    Recombinant Human POLR3G protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KPVPLKTGEGEEYMLALKQELRETMKRMPYFIETPEERQDIERYSKRYMK VYQEEWIPDWR
    • Amino acids
      44 to 104
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161076 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DNA directed RNA polymerase III 32 kDa polypeptide
    • DNA-directed RNA polymerase III subunit G
    • DNA-directed RNA polymerase III subunit RPC7
    • Polr3g
    • Polymerase (RNA) III (DNA directed) polypeptide G (32kD)
    • RNA polymerase III 32 kDa subunit
    • RNA polymerase III subunit C7
    • RPC32
    • RPC7
    • RPC7_HUMAN
    see all
  • Function
    DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. May direct with other members of the RPC3/POLR3C-RPC6/POLR3F-RPC7/POLR3G subcomplex RNA Pol III binding to the TFIIIB-DNA complex via the interactions between TFIIIB and POLR3F. May be involved either in the recruitment and stabilization of the subcomplex within RNA polymerase III, or in stimulating catalytic functions of other subunits during initiation. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway.
  • Sequence similarities
    Belongs to the eukaryotic RPC7 RNA polymerase subunit family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab161076 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161076 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161076.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up