Recombinant Human Polycystin 2 protein (ab114461)

Overview

  • Product nameRecombinant Human Polycystin 2 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ13563
    • SpeciesHuman
    • SequencePVSKTEKTNFKTLSSMEDFWKFTEGSLLDGLYWKMQPSNQTEADNRSFIF YENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGP
    • Molecular weight37 kDa including tags
    • Amino acids261 to 360

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114461 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    ab114461 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • APKD2
    • Autosomal dominant polycystic kidney disease type II
    • Autosomal dominant polycystic kidney disease type II protein
    • MGC138466
    • MGC138468
    • PC 2
    • PC2
    • PKD 2
    • PKD2
    • PKD2_HUMAN
    • PKD4
    • Polycystic kidney disease 2
    • Polycystic kidney disease 2 (autosomal dominant)
    • Polycystic kidney disease 2 protein
    • Polycystin 2
    • Polycystin 2 transient receptor potential cation channel
    • Polycystin-2
    • Polycystin2
    • Polycystwin
    • R48321
    • Transient receptor potential cation channel subfamily P member 2
    • TRPP2
    see all
  • FunctionFunctions as a calcium permeable cation channel. PKD1 and PKD2 may function through a common signaling pathway that is necessary for normal tubulogenesis.
  • Tissue specificityStrongly expressed in ovary, fetal and adult kidney, testis, and small intestine. Not detected in peripheral leukocytes.
  • Involvement in diseaseDefects in PKD2 are the cause of polycystic kidney disease autosomal dominant type 2 (ADPKD2) [MIM:613095]. ADPKD2 is a disorder characterized by progressive formation and enlargement of cysts in both kidneys, typically leading to end-stage renal disease in adult life. Cysts also occurs in the liver and other organs. It represents approximately 15% of the cases of autosomal dominant polycystic kidney disease. ADPKD2 is clinically milder than ADPKD1 but it has a deleterious impact on overall life expectancy.
  • Sequence similaritiesBelongs to the polycystin family.
    Contains 1 EF-hand domain.
  • DomainThe C-terminal coiled-coil domain binds calcium and undergoes a calcium-induced conformation change. It is implicated in oligomerization and the interaction with PKD1.
  • Cellular localizationMembrane. Endoplasmic reticulum.
  • Information by UniProt

Recombinant Human Polycystin 2 protein images

  • ab114461 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References for Recombinant Human Polycystin 2 protein (ab114461)

ab114461 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114461.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"