Recombinant Human Polycystin 2 protein (ab114461)

Overview

  • Product name
    Recombinant Human Polycystin 2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      PVSKTEKTNFKTLSSMEDFWKFTEGSLLDGLYWKMQPSNQTEADNRSFIF YENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGP
    • Molecular weight
      37 kDa including tags
    • Amino acids
      261 to 360

Specifications

Our Abpromise guarantee covers the use of ab114461 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    ab114461 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • APKD2
    • Autosomal dominant polycystic kidney disease type II
    • Autosomal dominant polycystic kidney disease type II protein
    • MGC138466
    • MGC138468
    • PC 2
    • PC2
    • PKD 2
    • PKD2
    • PKD2_HUMAN
    • PKD4
    • Polycystic kidney disease 2
    • Polycystic kidney disease 2 (autosomal dominant)
    • Polycystic kidney disease 2 protein
    • Polycystin 2
    • Polycystin 2 transient receptor potential cation channel
    • Polycystin-2
    • Polycystin2
    • Polycystwin
    • R48321
    • Transient receptor potential cation channel subfamily P member 2
    • TRPP2
    see all
  • Function
    Functions as a calcium permeable cation channel. PKD1 and PKD2 may function through a common signaling pathway that is necessary for normal tubulogenesis.
  • Tissue specificity
    Strongly expressed in ovary, fetal and adult kidney, testis, and small intestine. Not detected in peripheral leukocytes.
  • Involvement in disease
    Defects in PKD2 are the cause of polycystic kidney disease autosomal dominant type 2 (ADPKD2) [MIM:613095]. ADPKD2 is a disorder characterized by progressive formation and enlargement of cysts in both kidneys, typically leading to end-stage renal disease in adult life. Cysts also occurs in the liver and other organs. It represents approximately 15% of the cases of autosomal dominant polycystic kidney disease. ADPKD2 is clinically milder than ADPKD1 but it has a deleterious impact on overall life expectancy.
  • Sequence similarities
    Belongs to the polycystin family.
    Contains 1 EF-hand domain.
  • Domain
    The C-terminal coiled-coil domain binds calcium and undergoes a calcium-induced conformation change. It is implicated in oligomerization and the interaction with PKD1.
  • Cellular localization
    Membrane. Endoplasmic reticulum.
  • Information by UniProt

Images

  • ab114461 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab114461 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114461.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up