Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP01189
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMWCLESSQCQDLTTESNLLECIRACKPDLS AETPMFPGNGDEQPLTENPRKYVMGHFRWDRFGRRNSSSSGSSGAGQKRE DVSAGEDCGPLPEGGPEPRSDGAKPGPREGKRSYSMEHFRWGKPVGKKRR PVKVYPNGAEDESAEAFPLEFKRELTGQRLREGDGPDGPADDGAGAQADL EHSLLVAAEKKDEGPYRMEHFRWGSPPKDKRYGGFMTSEKSQTPLVTLFK NAIIKNAYKKGE
    • Molecular weight29 kDa including tags
    • Amino acids27 to 267
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab108118 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 85 % SDS-PAGE.
    ab108118 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 50% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • ACTH
    • Adrenocorticotropic hormone
    • Adrenocorticotropin
    • alpha melanocyte stimulating hormone
    • Alpha MSH
    • Alpha-MSH
    • beta endorphin
    • Beta LPH
    • beta melanocyte stimulating hormone
    • Beta MSH
    • Beta-LPH
    • Beta-MSH
    • CLIP
    • COLI_HUMAN
    • Corticotropin like intermediary peptide
    • Corticotropin lipotropin
    • Corticotropin-lipotropin
    • Gamma MSH
    • Gamma-LPH
    • Gamma-MSH
    • Lipotropin beta
    • Lipotropin gamma
    • LPH
    • Melanotropin
    • Melanotropin alpha
    • Melanotropin beta
    • Melanotropin gamma
    • met enkephalin
    • Met-enkephalin
    • MSH
    • NPP
    • POC
    • POMC
    • pro ACTH endorphin
    • Proopiomelanocortin
    • Proopiomelanocortin preproprotein
    see all
  • Information by UniProt

Recombinant Human POMC protein images

  • 15% SDS-PAGE showing ab108118 at approximately 28.9kDa (3µg).

References for Recombinant Human POMC protein (ab108118)

This product has been referenced in:
  • Van Ly D  et al. Characterising the mechanism of airway smooth muscle ß2 adrenoceptor desensitization by rhinovirus infected bronchial epithelial cells. PLoS One 8:e56058 (2013). Read more (PubMed: 23457497) »

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab108118.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"