Recombinant Human POPDC3 protein (ab163800)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MERNSSLWKNLIDEHPVCTTWKQEAEGAIYHLASILFVVGFMGGSGFFGL LYVFSLLGLGFLCSAVWAWVDVCAADIFSWNFVLFVICFMQFVHIAYQVR SITFAREFQVLYSSLFQPLGISLPVFRTIALSSEVVTLEKEHCYAMQGKT SIDKLSLLVSGRIRVTVDGEFLHYIFPLQFLDSPEWDSLRPTEEGIFQVT LTAETDCRYVSWRRKKLYLLFAQHRYISRLFSVLIGSDIADKLYALNDRV YIGKRYHYDIRLPNFYQMSTPEIRRSPLTQHFQNSRRYCDK
    • Amino acids
      1 to 291
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163800 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bA355M14.1
    • POP3
    • POPD3
    • POPD3_HUMAN
    • POPDC3
    • Popeye domain containing 3
    • Popeye domain containing protein 3
    • Popeye domain-containing protein 3
    • Popeye protein 3
    • RP11-99L11.2
    see all
  • Function
    May play an important role in heart development.
  • Tissue specificity
    Expressed predominantly in skeletal muscle and detected in heart.
  • Sequence similarities
    Belongs to the popeye family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab163800 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163800 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163800.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up