Recombinant Human POT1 protein (ab112404)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9NUX5
    • SpeciesHuman
    • SequenceMSLVPATNYIYTPLNQLKGGTIVNVYGVVKFFKPPYLSKGTDYCSVVTIV DQTNVKLTCLLFSGNYEALPIIYKNGDIVRFHRLKIQVYKKETQG
    • Molecular weight36 kDa including tags
    • Amino acids1 to 95

Specifications

Our Abpromise guarantee covers the use of ab112404 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesBest to use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • DKFZP586D211
    • hPot 1
    • hPot1
    • POT 1
    • POT1
    • POT1 like telomere end-binding protein
    • POT1 protection of telomeres 1 homolog
    • POT1-like telomere end-binding protein
    • POTE1_HUMAN
    • Protection of telomeres 1
    • Protection of telomeres 1 homolog (S. pombe)
    • Protection of telomeres protein 1
    see all
  • FunctionComponent of the telomerase ribonucleoprotein (RNP) complex that is essential for the replication of chromosome termini. Is a component of the double-stranded telomeric DNA-binding TRF1 complex which is involved in the regulation of telomere length by cis-inhibition of telomerase. Also acts as a single-stranded telomeric DNA-binding protein and thus may act as a downstream effector of the TRF1 complex and may transduce information about telomere maintenance and/or length to the telomere terminus. Component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. Shelterin associates with arrays of double-stranded TTAGGG repeats added by telomerase and protects chromosome ends; without its protective activity, telomeres are no longer hidden from the DNA damage surveillance and chromosome ends are inappropriately processed by DNA repair pathways. Binds to two or more telomeric single-stranded 5'-TTAGGG-3' repeats (G-strand) and with high specificity to a minimal telomeric single-stranded 5'-TAGGGTTAG-3' sequence. Binds telomeric single-stranded sequences internally or at proximity of a 3'-end. Its activity is TERT dependent but it does not increase TERT activity by itself. In contrast, the ACD-POT1 heterodimer enhances telomer elongation by increasing telomerase processivity.
  • Tissue specificityUbiquitous.
  • Sequence similaritiesBelongs to the telombin family.
  • Cellular localizationNucleus. Chromosome > telomere. Colocalizes with telomeric DNA.
  • Information by UniProt

Recombinant Human POT1 protein images

  • 12.5% SDS-PAGE analysis of ab112404. Stained with Coomassie Blue

References for Recombinant Human POT1 protein (ab112404)

ab112404 has not yet been referenced specifically in any publications.

Product Wall

Thanks for your inquiry. ab112404 binds to two or more telomeric single-stranded 5'-TTAGGG-3' repeats(G-strand) and with high specificity to a minimal telomeric single-stranded 5'-TAGGGTTAG-3' sequence. It binds telomeric single-stranded sequenc...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"