Recombinant Human POU3F2 protein (ab114812)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQS NGHPLSHAHQWITALSH
    • Molecular weight
      33 kDa including tags
    • Amino acids
      1 to 67

Specifications

Our Abpromise guarantee covers the use of ab114812 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Brain 2
    • Brain specific homeobox/POU domain protein 2
    • Brain-2
    • Brain-specific homeobox/POU domain protein 2
    • BRN 2
    • Brn-2
    • BRN2
    • N Oct 3
    • N OCT 3 Gene
    • N Oct3
    • Nervous system specific octamer binding transcription factor
    • Nervous system-specific octamer-binding transcription factor N-Oct-3
    • OCT 7
    • Oct-7
    • OCT7
    • Octamer Binding Transcription Factor 7
    • Octamer-binding protein 7
    • Octamer-binding transcription factor 7
    • OTF 7
    • OTF-7
    • OTF7
    • PO3F2_HUMAN
    • POU class 3 homeobox 2,
    • POU domain class 3 transcription factor 2
    • POU domain, class 3, transcription factor 2
    • Pou3f2
    • POUF 3
    • POUF3
    • Protein Brn 2
    see all
  • Function
    Transcription factor that binds preferentially to the recognition sequence which consists of two distinct half-sites, ('GCAT') and ('TAAT'), separated by a nonconserved spacer region of 0, 2, or 3 nucleotides. Positively regulates the genes under the control of corticotropin-releasing hormone (CRH) and CRH II promoters.
  • Tissue specificity
    Expressed specifically in the neuroectodermal cell lineage.
  • Sequence similarities
    Belongs to the POU transcription factor family. Class-3 subfamily.
    Contains 1 homeobox DNA-binding domain.
    Contains 1 POU-specific domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Recombinant Human POU3F2 protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human POU3F2 protein (ab114812)

ab114812 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114812.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up