Recombinant Human POU3F3 protein (ab114741)

Overview

  • Product name
    Recombinant Human POU3F3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      AAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITNLADSLQLEKEVV RVWFCNRRQKEKRMTPPGIQQQTPDDVYSQVGTVSADTPPPHHGLQTSVQ
    • Molecular weight
      37 kDa including tags
    • Amino acids
      401 to 500

Specifications

Our Abpromise guarantee covers the use of ab114741 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Brain 1
    • Brain specific homeobox/POU domain protein 1
    • Brain-1
    • Brain-specific homeobox/POU domain protein 1
    • Brain-specific homeobox/POU domain protein 1.1
    • Brain1
    • BRN 1
    • Brn-1
    • BRN1
    • Brn1, mouse, homolog of
    • class 3
    • Class III POU domain protein taichi
    • Oct-8
    • Octamer-binding protein 8
    • Octamer-binding transcription factor 8
    • OTF 8
    • OTF-8
    • OTF8
    • PO3 F3
    • PO3F 3
    • PO3F3
    • PO3F3_HUMAN
    • POU class 3 homeobox 3
    • POU domain
    • POU domain protein 12
    • POU domain, class 3, transcription factor 3
    • POU domain, class 3, transcription factor 3-A
    • pou12
    • POU3 F3
    • POU3F 3
    • Pou3f3
    • RHS 1
    • Rhs 2
    • RHS1
    • Rhs2
    • Skin 1
    • Skin1
    • tai-ji
    • transcription factor 3
    • zp12
    • zp12pou
    see all
  • Function
    Transcription factor that acts synergistically with SOX11 and SOX4. Plays a role in neuronal development. Is implicated in an enhancer activity at the embryonic met-mesencephalic junction; the enhancer element contains the octamer motif (5'-ATTTGCAT-3').
  • Tissue specificity
    Brain.
  • Sequence similarities
    Belongs to the POU transcription factor family. Class-3 subfamily.
    Contains 1 homeobox DNA-binding domain.
    Contains 1 POU-specific domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114741 at approximately 36.63kDa.
    Stained with Coomassie Blue.

References

ab114741 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114741.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up