Recombinant Human POU3F3 protein (ab114741)

Overview

  • Product nameRecombinant Human POU3F3 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP20264
    • SpeciesHuman
    • SequenceAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITNLADSLQLEKEVV RVWFCNRRQKEKRMTPPGIQQQTPDDVYSQVGTVSADTPPPHHGLQTSVQ
    • Molecular weight37 kDa including tags
    • Amino acids401 to 500

Specifications

Our Abpromise guarantee covers the use of ab114741 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Brain 1
    • Brain specific homeobox/POU domain protein 1
    • Brain-1
    • Brain-specific homeobox/POU domain protein 1
    • Brain-specific homeobox/POU domain protein 1.1
    • Brain1
    • BRN 1
    • Brn-1
    • BRN1
    • Brn1, mouse, homolog of
    • class 3
    • Class III POU domain protein taichi
    • Oct-8
    • Octamer-binding protein 8
    • Octamer-binding transcription factor 8
    • OTF 8
    • OTF-8
    • OTF8
    • PO3 F3
    • PO3F 3
    • PO3F3
    • PO3F3_HUMAN
    • POU class 3 homeobox 3
    • POU domain
    • POU domain protein 12
    • POU domain, class 3, transcription factor 3
    • POU domain, class 3, transcription factor 3-A
    • pou12
    • POU3 F3
    • POU3F 3
    • Pou3f3
    • RHS 1
    • Rhs 2
    • RHS1
    • Rhs2
    • Skin 1
    • Skin1
    • tai-ji
    • transcription factor 3
    • zp12
    • zp12pou
    see all
  • FunctionTranscription factor that acts synergistically with SOX11 and SOX4. Plays a role in neuronal development. Is implicated in an enhancer activity at the embryonic met-mesencephalic junction; the enhancer element contains the octamer motif (5'-ATTTGCAT-3').
  • Tissue specificityBrain.
  • Sequence similaritiesBelongs to the POU transcription factor family. Class-3 subfamily.
    Contains 1 homeobox DNA-binding domain.
    Contains 1 POU-specific domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human POU3F3 protein images

  • 12.5% SDS-PAGE showing ab114741 at approximately 36.63kDa.
    Stained with Coomassie Blue.

References for Recombinant Human POU3F3 protein (ab114741)

ab114741 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114741.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"