Recombinant Human POU4F3 protein (ab152628)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MMAMNSKQPFGMHPVLQEPKFSSLHSGSEAMRRVCLPAPQLQGNIFGSFD ESLLARAEALAAVDIVSHGKNHPFKPDATYHTMSSVPCTSTSSTVPISHP AALTSHPHHAVHQGLEGDLLEHISPTLSVSGLGAPEHSVMPAQIHPHHLG AMGHLHQAMGMSHPHTVAPHSAMPACLSDVESDPRELEAFAERFKQRRIK LGVTQADVGAALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQA WLEEAEAAYREKNSKPELFNGSERKRKRTSIAAPEKRSLEAYFAIQPRPS SEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAVH
    • Molecular weight
      64 kDa including tags
    • Amino acids
      1 to 338

Specifications

Our Abpromise guarantee covers the use of ab152628 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Brain specific homeobox/POU domain protein 3C
    • Brain-3C
    • Brain-specific homeobox/POU domain protein 3C
    • BRN 3C
    • Brn-3C
    • BRN3C
    • class 4
    • DFNA 15
    • DFNA15
    • MGC138412
    • PO4F3_HUMAN
    • POU class 4 homeobox 3
    • POU domain
    • POU domain class 4 transcription factor 3
    • POU4F3
    • transcription factor 3
    see all
  • Function
    May play a role in determining or maintaining the identities of a small subset of visual system neurons.
  • Tissue specificity
    Brain. Seems to be specific to the retina.
  • Involvement in disease
    Defects in POU4F3 are the cause of deafness autosomal dominant type 15 (DFNA15) [MIM:602459]. DFNA15 is a form of sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information.
  • Sequence similarities
    Belongs to the POU transcription factor family. Class-4 subfamily.
    Contains 1 homeobox DNA-binding domain.
    Contains 1 POU-specific domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab152628 stained with Coomassie Blue.

References

ab152628 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152628.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up