Recombinant Human POU6F2 protein (ab161401)

Overview

  • Product name
    Recombinant Human POU6F2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      IAGQVSKPLLSVRSEMNAELRGEDKAATSDSELNEPLLAPVESNDSEDTP SKLFGARGNPALSDPGTPDQHQASQTHPPFPVGPQP
    • Amino acids
      2 to 87
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161401 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • POU class 6 homeobox 2
    • POU domain class 6 transcription factor 2
    • Retina derived POU domain factor 1
    • RPF 1
    • RPF1
    • Wilms tumor suppressor locus
    • WT 5
    • WT5
    • WTSL
    see all
  • Relevance
    POU6F2 (POU class 6 homeobox 2) is a member of the POU domain family of transcription factors. It recognizes and binds to the DNA sequence 5'-ATGCAAAT-3' and may be involved in the early steps in the differentiation of amacrine and ganglion cells.
  • Cellular localization
    Nuclear

Images

  • ab161401 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161401 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161401.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up