Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EGLVDYYSHIYDGPWDSYPDVLAMQFNWDGYYKEVGSAFIGSSPEFEFAL YSLCFIARPGKVCQLSLGGYPLAVRTYTWDKSTYGNGKKYIATAYIVSST
    • Amino acids
      270 to 369
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160260 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 22 serine protease
    • 26 serine protease
    • Endonuclease, polyU-specific
    • endou
    • ENDOU_HUMAN
    • P11
    • Placental protein 11
    • Poly(U)-specific endoribonuclease
    • PP11
    • Pp11r
    • Protein endoU
    • PRSS26
    • Uridylate-specific endoribonuclease
    see all
  • Function
    Endoribonuclease that cleaves single-stranded RNAs at uridylates and releases products that have 2'-3'-cyclic phosphate termini.
  • Tissue specificity
    Placental-specific, but also associated with various malignant neoplasms.
  • Sequence similarities
    Belongs to the ENDOU family.
    Contains 2 SMB (somatomedin-B) domains.
  • Post-translational
    modifications
    It has been suggested that the active SMB domain may be permitted considerable disulfide bond heterogeneity or variability, thus two alternate disulfide patterns based on 3D structures are described with 1 disulfide bond conserved in both.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab160260 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160260 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160260.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up