Recombinant Human PP1C gamma protein (ab114828)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP36873
    • SpeciesHuman
    • SequenceMADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQP ILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQS LETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWK TFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGL LCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQV VEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE KKKPNATRPVTPPRGMITKQAKK
    • Molecular weight61 kDa including tags
    • Amino acids1 to 323

Specifications

Our Abpromise guarantee covers the use of ab114828 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • PP 1G
    • PP-1G
    • PP1C
    • PP1G
    • PP1G_HUMAN
    • PP1gamma
    • PPP 1G
    • PPP1CC
    • PPP1G
    • Protein phosphatase 1, catalytic subunit, gamma isozyme
    • Protein phosphatase 1C catalytic subunit
    • Serine/threonine phosphatase 1 gamma
    • Serine/threonine protein phosphatase PP1 gamma catalytic subunit
    • Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
    see all
  • FunctionProtein phosphatase 1 (PP1) is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. May play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca(2+)/calmodulin dependent protein kinase II. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase.
  • Sequence similaritiesBelongs to the PPP phosphatase family. PP-1 subfamily.
  • Cellular localizationCytoplasm. Nucleus. Nucleus > nucleolus. Nucleus > nucleoplasm. Nucleus speckle. Chromosome > centromere > kinetochore. Cleavage furrow. Midbody. Colocalizes with SPZ1 in the nucleus (By similarity). Rapidly exchanges between the nucleolar, nucleoplasmic and cytoplasmic compartments. Highly mobile in cells and can be relocalized through interaction with targeting subunits. In the presence of PPP1R8 relocalizes from the nucleolus to nuclear speckles. Shows a dynamic targeting to specific sites throughout the cell cycle. Highly concentrated in nucleoli of interphase cells and localizes at kinetochores early in mitosis. Relocalization to chromosome-containing regions occurs at the transition from early to late anaphase. Also accumulates at the cleavage furrow and midbody by telophase.
  • Information by UniProt

Recombinant Human PP1C gamma protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human PP1C gamma protein (ab114828)

ab114828 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114828.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"