Recombinant Human PP1C gamma protein (ab152022)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Tags: His tag C-Terminus, His tag N-Terminus
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human PP1C gamma protein
See all PP1C gamma proteins and peptides -
Purity
> 95 % SDS-PAGE.
Purity is greater than 95% as determined by reducing SDS-PAGE. ab152022 has been 0.2 µM filtered. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQP ILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQS LETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWK TFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGL LCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQV VEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE KKKPNATRPVTPPRGMITKQAKK -
Predicted molecular weight
37 kDa -
Amino acids
1 to 323 -
Tags
His tag C-Terminus , His tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab152022 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 8.00
Constituents: 0.02% DTT, 0.32% Tris HCl
General Info
-
Alternative names
- PP 1G
- PP-1G
- PP1C
see all -
Function
Protein phosphatase 1 (PP1) is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. May play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca(2+)/calmodulin dependent protein kinase II. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase. -
Sequence similarities
Belongs to the PPP phosphatase family. PP-1 subfamily. -
Cellular localization
Cytoplasm. Nucleus. Nucleus > nucleolus. Nucleus > nucleoplasm. Nucleus speckle. Chromosome > centromere > kinetochore. Cleavage furrow. Midbody. Colocalizes with SPZ1 in the nucleus (By similarity). Rapidly exchanges between the nucleolar, nucleoplasmic and cytoplasmic compartments. Highly mobile in cells and can be relocalized through interaction with targeting subunits. In the presence of PPP1R8 relocalizes from the nucleolus to nuclear speckles. Shows a dynamic targeting to specific sites throughout the cell cycle. Highly concentrated in nucleoli of interphase cells and localizes at kinetochores early in mitosis. Relocalization to chromosome-containing regions occurs at the transition from early to late anaphase. Also accumulates at the cleavage furrow and midbody by telophase. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab152022 has not yet been referenced specifically in any publications.