Recombinant Human PP2A-alpha protein (ab114424)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRC PVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLL VALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLF DYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLW SDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNW CHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV TRRTPDYFL
    • Molecular weight
      60 kDa including tags
    • Amino acids
      1 to 309
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab114424 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • PP2A alpha
    • PP2A-alpha
    • PP2AA_HUMAN
    • PP2Aalpha
    • PP2Ac
    • PP2CA
    • PP2Calpha
    • PPP2CA
    • Protein phosphatase 2 (formerly 2A) catalytic subunit alpha isoform
    • Protein phosphatase 2 catalytic subunit alpha isoform
    • Protein phosphatase 2, catalytic subunit, alpha isozyme
    • Protein phosphatase 2A catalytic subunit, alpha isoform
    • Replication protein C
    • RP C
    • RP-C
    • RPC
    • Serine/threonine protein phosphatase 2A catalytic subunit alpha isoform
    • Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
    see all
  • Function
    PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase. Cooperates with SGOL2 to protect centromeric cohesin from separase-mediated cleavage in oocytes specifically during meiosis I (By similarity). Can dephosphorylate SV40 large T antigen and p53/TP53. Dephosphorylates SV40 large T antigen, preferentially on serine residues 120, 123, 677, and perhaps 679. The C subunit was most active, followed by the AC form, which was more active than the ABC form, and activity of all three forms was strongly stimulated by manganese, and to a lesser extent by magnesium. Dephosphorylation by the AC form, but not C or ABC form is inhibited by small T antigen.
  • Sequence similarities
    Belongs to the PPP phosphatase family. PP-1 subfamily.
  • Post-translational
    modifications
    Reversibly methyl esterified on Leu-309. Carboxyl methylation may play a role in holoenzyme assembly. It varies during the cell cycle.
    Phosphorylation of either threonine (by autophosphorylation-activated protein kinase) or tyrosine results in inactivation of the phosphatase. Auto-dephosphorylation has been suggested as a mechanism for reactivation.
  • Cellular localization
    Cytoplasm. Nucleus. Chromosome > centromere. Cytoplasm > cytoskeleton > spindle pole. In prometaphase cells, but not in anaphase cells, localizes at centromeres. During mitosis, also found at spindle poles. Centromeric localization requires the presence of SGOL2.
  • Information by UniProt

Images

  • ab114424 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114424 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114424.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up