Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAMAEGERTECAEPPRDEPPADGALKRAEELKTQANDYFKAKDYENA I KFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKK YI KGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNK IVK QKAFERAIAGDEHKRSVVDSLDIESMTIEDEYSGPKLEDGKVTI SFMK ELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETE KITVC GDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEV ILTLFG FKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYE LFSEVFE WLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPP DSGPMCDL LWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNLDYI IRSHEVKAE GYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLR PQFHQFTAVP HPNVKPMAYANTLLQLGMM
    • Amino acids
      1 to 499

Specifications

Our Abpromise guarantee covers the use of ab91714 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Form
    Lyophilised
  • Additional notes
    Protein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch).
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5

  • Reconstitution
    Reconstitute with 140 µl aqua dest.

General Info

  • Alternative names
    • FLJ36922
    • FLJ55954
    • OTTHUMP00000165834
    • PP-T
    • PP5
    • PPP5
    • PPP5_HUMAN
    • Ppp5c
    • PPT
    • Protein phosphatase 5, catalytic subunit
    • Protein phosphatase T
    • Serine/threonine protein phosphatase 5
    • Serine/threonine-protein phosphatase 5
    see all
  • Function
    May play a role in the regulation of RNA biogenesis and/or mitosis. In vitro, dephosphorylates serine residues of skeletal muscle phosphorylase and histone H1.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the PPP phosphatase family. PP-5 (PP-T) subfamily.
    Contains 3 TPR repeats.
  • Cellular localization
    Nucleus. Cytoplasm. Predominantly nuclear. But also present in the cytoplasm.
  • Information by UniProt

Recombinant Human PP5 protein images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue

References for Recombinant Human PP5 protein (ab91714)

ab91714 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab91714.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up