Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAMAEGERTECAEPPRDEPPADGALKRAEELKTQANDYFKAKDYENAIKF YSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYY RRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQKAFER AIAGDEHKRSVVDSLDIESMTIEDEYSGPKLEDGKVTISFMKELMQWYKD QKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDL LNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLL RGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLI MHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKR GVSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPN YCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYANTLLQLGMM
    • Amino acids
      1 to 499

Specifications

Our Abpromise guarantee covers the use of ab91714 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Form
    Lyophilised
  • Additional notes
    Protein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch).
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5

  • Reconstitution
    Reconstitute with 140 µl aqua dest.

General Info

  • Alternative names
    • FLJ36922
    • FLJ55954
    • OTTHUMP00000165834
    • PP-T
    • PP5
    • PPP5
    • PPP5_HUMAN
    • Ppp5c
    • PPT
    • Protein phosphatase 5, catalytic subunit
    • Protein phosphatase T
    • Serine/threonine protein phosphatase 5
    • Serine/threonine-protein phosphatase 5
    see all
  • Function
    May play a role in the regulation of RNA biogenesis and/or mitosis. In vitro, dephosphorylates serine residues of skeletal muscle phosphorylase and histone H1.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the PPP phosphatase family. PP-5 (PP-T) subfamily.
    Contains 3 TPR repeats.
  • Cellular localization
    Nucleus. Cytoplasm. Predominantly nuclear. But also present in the cytoplasm.
  • Information by UniProt

Images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue

References

ab91714 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab91714.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up